SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|334828|NCBI_GNO_41900003 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|334828|NCBI_GNO_41900003
Domain Number 1 Region: 99-125
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000458
Family LDL receptor-like module 0.0021
Further Details:      
 
Domain Number 2 Region: 67-91
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000183
Family LDL receptor-like module 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|334828|NCBI_GNO_41900003
Sequence length 188
Sequence
MKSEYSKTWSSAPHFWETFTSQQGRRPIDNKYNFRYCSESEGFYCMNIVYRNQQQQYYLR
SRGVTQPGCLNRNQICDGHTDCASGVDEENCDGNCIAGFKCGRQCISKEKVCDGNYDCVD
GSDEHYDCEYAKSCSELKYTYGSFSSLTIDSDNVFIKMPPKKLSSQYRYKATKSFGYLSV
CSTLKKTI
Download sequence
Identical sequences E9HWG9
jgi|Dappu1|334828|NCBI_GNO_41900003

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]