SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|336042|NCBI_GNO_83300004 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|336042|NCBI_GNO_83300004
Domain Number 1 Region: 93-177
Classification Level Classification E-value
Superfamily C-type lectin-like 0.0000605
Family Invasin/intimin cell-adhesion fragment, C-terminal domain 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|336042|NCBI_GNO_83300004
Sequence length 388
Sequence
MACGKNLILILFILAHTFGNVAISPSILKGGLVYSEESSLGPVYLNRDQVNFIRTIDTSA
LQKSAQAVKDFTTLYHTFCQRVSNFVTPIENIPPFDTDESNDYEIVFSPVKYSMKEGHQV
CKNMGARLPEIRNRDSYNEIRFAAMKKRVKSIRAGIYFDTGTSTFRYYSDDTPANADIGK
SPFGHISYGGEWVGGRYKGAWEHDSAIIAPNMAPKHIMLYVDPETEFSLRLSDRNEEVYL
DYILCQKPIDKSTYETTRENNILLQLAHHACRRDEKQIVTSTRYILTEIEAITNLNITLN
EYEPKMSDYFPNILESDENINSDRSKRNASSKAKKTKQEVDRDIDSLNTSFKKLIKLLSI
QVTTPTPETTTTLLLLQQLQLPLKNLYT
Download sequence
Identical sequences E9HZ00
jgi|Dappu1|336042|NCBI_GNO_83300004

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]