SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|336720|NCBI_GNO_113500002 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|336720|NCBI_GNO_113500002
Domain Number 1 Region: 65-134
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 4.59e-19
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 2 Region: 8-76
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000208
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 3 Region: 118-192
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000556
Family Complement control module/SCR domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|336720|NCBI_GNO_113500002
Sequence length 210
Sequence
MPVCVTRSCGDPPNIDNGFAVVRGTGVGDTISYSCQTGHRLSGVESRTCLSNGRCSGEDP
ACDPVVCAVPEAPEDGSWTVDGFVPGSTIRFECKLGFTLVGSATVTCLTDKSWSDRTPSC
QQITCPPLRDPEHGTVQLTNWISDNQELNNDINQQLAVGYHSTAHYTCNRGYQLFGPGQR
TCTDQGTWSDRGPQYRRVWCPEPQAPCKDL
Download sequence
Identical sequences E9I077
jgi|Dappu1|336720|NCBI_GNO_113500002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]