SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|337859|NCBI_GNO_183700001 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|337859|NCBI_GNO_183700001
Domain Number 1 Region: 66-327
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 6.67e-85
Family alpha-mannosidase 0.0000000874
Further Details:      
 
Domain Number 2 Region: 429-752
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 6.75e-81
Family alpha-mannosidase, C-terminal domain 0.000000666
Further Details:      
 
Domain Number 3 Region: 329-424
Classification Level Classification E-value
Superfamily Families 57/38 glycoside transferase middle domain 6.87e-27
Family alpha-mannosidase, domain 2 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|337859|NCBI_GNO_183700001
Sequence length 752
Sequence
MKFLSHTSIDYNGKWLLYLILRPVRILRFFTVWRSWVPTLGSYQYEKNVYCQTSVSRKVI
HLNVTYNFFFKWWQEQTETTKALVRTLVNEGRLEFINGGWCMNDEATAHYVDIIDQMSFG
LITLNDTFGECGRPRISWQIDPFGHSREQASLFAQMGYDGLFFGRLDHEDKKERMAKKTM
EMVWSGSDSLGTQASLFTAVNYNLYQPPPGFCFDIYCNDEPIIDDPRSKDYNVEKRVTDF
LNYCQEQANAYATDSILLTMGSDFHYQDANVWFKNMDKLIKYANERQATGSRFNLFYSTP
SCYTKALNDHAKTWPSKTGDFFPYGSDAHAYWTGYFTSRPASKYMIRQGSNLMQVCKQMD
AALVRQGVATNQVGELFTMKDAMGIMQHHDAVTGTEKQHVAEDYALLLHKGVVECQKIQT
AYYEKELVIGNQVLPKVSYCQLNVSQCDPTEKNNRFVVNIYNSMARSVDKYVRVPVASGT
IFQVHDPQGNVVASQTVPIAEYVKSLPGRVSSATVELVFLASQLPPLGSKSYYVQPGTSK
DEHEPQNKFAISNEKVSVEIDDVRGLIKSVTVNGKTTELKQEFLWYPSKSGDNSVADKRA
SGAYIFRPDSDGAFAIPSSGITTTTYSGELVEEVHQIYNPWVAQTIRLYKGQEHVELDWV
VGPIPVEDGTGKEIINRVTTSIASSGMFYTDANGRQTLERRFNIRDSYPYTVTEPIAANY
YPVNSHAYIKDAVGNQVTMLVDRPQGGSSLHN
Download sequence
Identical sequences E9I283
jgi|Dappu1|337859|NCBI_GNO_183700001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]