SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|338542|NCBI_GNO_242000001 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|338542|NCBI_GNO_242000001
Domain Number 1 Region: 25-51
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000589
Family LDL receptor-like module 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|338542|NCBI_GNO_242000001
Sequence length 55
Sequence
MITIQPKPGFTFEDDFHWGQLHRRGKDNRCIPLYWRCDGEKDRQDGTDDSSSYLK
Download sequence
Identical sequences E9I2W9
jgi|Dappu1|338542|NCBI_GNO_242000001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]