SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|343157|NCBI_GNO_882900001 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|343157|NCBI_GNO_882900001
Domain Number 1 Region: 1-113
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 1.11e-31
Family alpha-mannosidase 0.000028
Further Details:      
 
Domain Number 2 Region: 117-230
Classification Level Classification E-value
Superfamily Families 57/38 glycoside transferase middle domain 2.22e-30
Family alpha-mannosidase, domain 2 0.0000698
Further Details:      
 
Domain Number 3 Region: 242-345
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 3.3e-16
Family alpha-mannosidase, C-terminal domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|343157|NCBI_GNO_882900001
Sequence length 348
Sequence
CPWKVPPQPITNVNVEKRASLLLDQYRKKSTLYKTNVLLVQLGDDFRYDTAAEFDQQFIN
YQKLFDYMNSRSDWFVEAQFGTLKDYFDSLRANVAQSVESFPSLSGDFFTYADIDDHYWS
GYYTSRPFYKQLDRVLESYLRSAEIIYSMTWSHLHRQSTVPERFRSWMSRMMALLSEARR
HLSLFQHHDGITGTEKDHVVQDYAKMMQTAIQGSQTIIQQCAHFLLHPDQANLEPQLNTR
HFLVDDEYSKPNELPRKSLIRLQDAKRVVFYNSLASERVQVVTLRISEYNVEVMNEKSEP
IKVQVSPVFITSHQLSPEEFDISFVISVSPLGMSTYTIRKFVGTTQEN
Download sequence
Identical sequences jgi|Dappu1|343157|NCBI_GNO_882900001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]