SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|345208|NCBI_GNO_1230500001 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Dappu1|345208|NCBI_GNO_1230500001
Domain Number - Region: 143-224
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 0.000763
Family Terpene synthases 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|345208|NCBI_GNO_1230500001
Sequence length 240
Sequence
MEEVKKAIVELGIKYRLASKHTSFVGVDDKAAKGDFELAINTRDIKNQVPSGFGYGMPRG
MASRGAAPIMMYRRESFHKPVYGGSSSLSRTRMRNVTTLAPKAAVHAQIESLSHPAAEMD
PFALDCFLTNSSGMPMEQKAAVQEDKLTSLIDLQSSDGHFKWGDVITRCTGKSNDELATK
RSSFVTDNDLWLTAIVIGLLEAMTNEKDLWELVVQKALKYLSNLLKEEEMERIFKAARQI
Download sequence
Identical sequences E9I794
jgi|Dappu1|345208|NCBI_GNO_1230500001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]