SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|36077|gw1.4.981.1 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|36077|gw1.4.981.1
Domain Number 1 Region: 3-36
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000974
Family EGF-type module 0.019
Further Details:      
 
Domain Number 2 Region: 33-67
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000639
Family EGF-type module 0.024
Further Details:      
 
Domain Number 3 Region: 67-98
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000963
Family EGF-type module 0.028
Further Details:      
 
Weak hits

Sequence:  jgi|Dappu1|36077|gw1.4.981.1
Domain Number - Region: 100-128
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000677
Family EGF-type module 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|36077|gw1.4.981.1
Sequence length 129
Sequence
CTIPCRNGGTCLRRNRCQCPESFVGRQCQWNAPTCHPSCLNGGHCSRRKVCSCKKGWTGT
RCEIAICALPCLNGGICSSPGKCTCPDDYQGSRCQKAVCKPKCRRGGKCIGPGICLCRAG
FAGSNCELR
Download sequence
Identical sequences E9FY24
jgi|Dappu1|36077|gw1.4.981.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]