SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|39669|e_gw1.1.594.1 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|39669|e_gw1.1.594.1
Domain Number 1 Region: 233-277
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000031
Family EGF-type module 0.0032
Further Details:      
 
Domain Number 2 Region: 68-184
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000157
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 3 Region: 313-350
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000565
Family EGF-type module 0.01
Further Details:      
 
Domain Number 4 Region: 202-239
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000385
Family EGF-type module 0.025
Further Details:      
 
Domain Number 5 Region: 274-318
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000742
Family EGF-type module 0.032
Further Details:      
 
Weak hits

Sequence:  jgi|Dappu1|39669|e_gw1.1.594.1
Domain Number - Region: 354-391
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000255
Family EGF-type module 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|39669|e_gw1.1.594.1
Sequence length 405
Sequence
MIGIDCCAVIIGLAAFLTASSSATTQSSSSDGNNSINDPELIEQVELHYHHPPSSAGAAA
ALRNDVLACQSDPCFHGLCIDHTNNSTYSCFCEDGYTGYQCQTNWNECWNGPCKHGGTCV
DGIGRYHCLCRPGFTGDDCQVDIDECQSDPCQNGATCQDGDNGYRCRCLPGYEGAFCQVD
VAVCRHQQHNNDTSSRDIFLPPTCRHGARCVEGPGLAYHCLCPEGWTGKHCETDVDECCS
NPCKNGGHCIDFIGSYQCACAHGFTGRNCETALERCDDKLCGYQGMCWLDGDDGQTSCYC
RPDFHGAHCEDQYNECLLPGTKCLNGGQCIDQVDGYSCSCPPLWTGSRCQSCEIRQCPCN
PCQVNSTCLMSPNDQMVCVCSYGRIGSLCEIGKSLFTKIYFHFTS
Download sequence
Identical sequences E9FR30
jgi|Dappu1|39669|e_gw1.1.594.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]