SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|40490|e_gw1.2.36.1 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|40490|e_gw1.2.36.1
Domain Number 1 Region: 11-245
Classification Level Classification E-value
Superfamily vWA-like 1.07e-57
Family Integrin A (or I) domain 0.0000032
Further Details:      
 
Domain Number 2 Region: 233-332
Classification Level Classification E-value
Superfamily Integrin domains 6.28e-19
Family Integrin domains 0.0015
Further Details:      
 
Domain Number 3 Region: 523-606
Classification Level Classification E-value
Superfamily Integrin beta tail domain 0.0000000000131
Family Integrin beta tail domain 0.0023
Further Details:      
 
Domain Number 4 Region: 482-517
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000809
Family Integrin beta EGF-like domains 0.015
Further Details:      
 
Weak hits

Sequence:  jgi|Dappu1|40490|e_gw1.2.36.1
Domain Number - Region: 421-465
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00558
Family Integrin beta EGF-like domains 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|40490|e_gw1.2.36.1
Sequence length 681
Sequence
NFQIKFRRVSGYPVDLYYIMDLSTSMKPSKEKLVNLAASLAEAMRNITTDFRMGFGSFID
KPMSPFANEIQPSKPYLFRHHMKLSSDATTFALQVNGAPTFDNLDSPEGGLEALMQAVVC
KNEIGWRSNSHRLIIFSTDAPYHLAGDGKLAGITSPNDESCHVSQDGDGRFHYDHFRLLD
YPSMAQISRQIANNSMNVIFAVPFAVRLIYQDLSSRLFGASVAELTDDSSNIVALVQEQY
NKISSSVKMSHRASKYVSVSYSSSCSSNGQSINTNRCDGIKTGSTVTFNVTISVSNCPKG
NNFEEVIEFFPVGVNEVVTVGLDVICQCGCDEATTTQNECSGAGKYMCGFCVCNPGFSGS
SCECGSGTERKPNPFAKGCKPPHQGNSSAFPDCSGRGNCICDAACNCRSPPGRKVWGDYC
ECDDFACPISPINQLVCSGPDQGTCPCNGGGVCECLPGWQGNSCQSKCPENTETCYASGE
ISKGAMCSDRGTCNCGQCLCSKTKEGDPYTGKFCEIPPVSIYFCNELKECVQCKAFNTGP
LSKDGCRNCEFNVTLVEEIKETKEGDQICSFQQYQDGLYCNFFFVHNRLKMESNIPVGEK
GECSEPPNIIAIVSGVAGAILAIGLLLLLLWKILTTIHDRLEYAKFLRDRDLAKWPRGEN
PIYKRPTTIFLNPAYSVGNED
Download sequence
Identical sequences E9FTE9
jgi|Dappu1|40490|e_gw1.2.36.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]