SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|40603|e_gw1.2.580.1 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|40603|e_gw1.2.580.1
Domain Number 1 Region: 122-173
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 4.99e-16
Family Ovomucoid domain III-like 0.0071
Further Details:      
 
Domain Number 2 Region: 225-272
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000000079
Family Ovomucoid domain III-like 0.0078
Further Details:      
 
Domain Number 3 Region: 4-55
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000000305
Family Ovomucoid domain III-like 0.0078
Further Details:      
 
Domain Number 4 Region: 279-327
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000112
Family Ovomucoid domain III-like 0.0032
Further Details:      
 
Domain Number 5 Region: 69-114
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000498
Family Ovomucoid domain III-like 0.012
Further Details:      
 
Domain Number 6 Region: 177-222
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000638
Family Ovomucoid domain III-like 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|40603|e_gw1.2.580.1
Sequence length 337
Sequence
LNYYLLGAPSCNVFCTFEFNPICGTDGQTYSNPCSLNAKNQCDGTAISKAYNGRCTTAAT
TPTCTADDETPLVCGCPCAIRCSNEYIPLCGNDGKTYRNPCQLAVANSLDEGEIANLEDD
ELAKMAAPCQIFCTLEYMPVCGTDGKTYPNICHLNAYNKCHGTHIEKAHDGPCLPYEFCV
PDPHPPVCGTDGKTYRNACQLARSNACLHPPEVKVCHKGPCKFGHLPCRMPCTREYNPVC
GTDGRTYANPCVLKAKNTCDGTRVHKAYDGVCVSGQQGCELPCNGPGYSFNPICGSNGKT
YDNECELNGRNKCDGTKIEKAHDGECEPSQPEAIPYL
Download sequence
Identical sequences E9FSE6
jgi|Dappu1|40603|e_gw1.2.580.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]