SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|42533|e_gw1.4.708.1 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|42533|e_gw1.4.708.1
Domain Number 1 Region: 133-170
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000315
Family EGF-type module 0.0068
Further Details:      
 
Weak hits

Sequence:  jgi|Dappu1|42533|e_gw1.4.708.1
Domain Number - Region: 92-142
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000159
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|42533|e_gw1.4.708.1
Sequence length 197
Sequence
NNQPPVVSNRLKTTAYDGQMLEYVIHATDQDPLHFRLVDPLSDAQVTKEGVFRWKAVSNA
LSPFNQETFALTVSDQCNHPVHFHLHVDVLPCPCINGGACRNPPDDFITSNQIDPTYRCH
CREGFTGQDCGIRIDFCDPNPCRDGLCLNEVDGYVCDCLPGFKGPHCDQTDDSAIENDLS
PVFSKPNETSVKQGELN
Download sequence
Identical sequences E9FY25
jgi|Dappu1|42533|e_gw1.4.708.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]