SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|42869|e_gw1.5.2.1 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|42869|e_gw1.5.2.1
Domain Number 1 Region: 743-826,862-948,1002-1128
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 5.62e-18
Family All0351-like 0.046
Further Details:      
 
Weak hits

Sequence:  jgi|Dappu1|42869|e_gw1.5.2.1
Domain Number - Region: 414-487
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.000173
Family Pre-dockerin domain 0.088
Further Details:      
 
Domain Number - Region: 248-273
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00318
Family Integrin beta EGF-like domains 0.068
Further Details:      
 
Domain Number - Region: 68-92
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00394
Family Integrin beta EGF-like domains 0.064
Further Details:      
 
Domain Number - Region: 1032-1243
Classification Level Classification E-value
Superfamily YVTN repeat-like/Quinoprotein amine dehydrogenase 0.00863
Family YVTN repeat 0.061
Further Details:      
 
Domain Number - Region: 216-240
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0151
Family EGF-type module 0.051
Further Details:      
 
Domain Number - Region: 97-124
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0167
Family Integrin beta EGF-like domains 0.046
Further Details:      
 
Domain Number - Region: 146-171
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0435
Family Integrin beta EGF-like domains 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|42869|e_gw1.5.2.1
Sequence length 2271
Sequence
MARFRRQLNSSSSPTTSSRPAYYNTSLVKPVEPGRWFLAVYNDDSQRQDVAVGLTLTNEV
ATPCPDDCNGRGQCLNGKCLCRDGFAGTDCSTSVCPVLCSGRGAYGGGRCHCEAGWTGAE
CDQPYSELSAASSSTGGGFVISCSIPCSVHGTCVNGRCQCDTEHTGASCETRKLTGILCS
PARARRIKSIYVLRGGEGDRRGWCSEGALLTCQSDCGPNGRCVNSSCLCNAGWMGSRCHL
VSTSCDPRCSQHGQCVNGTCICSRGWNGRHCTLDGCPGNCGNNRGVCLQSGKSGNGINSL
LLANQFRCECAPGWTGTDCSIMTETECGDDKDNDGDGLTDCADSDCCSNPSCTDHLMCLA
SADPADIASRKPVLSSNGGGASSFYQRVKFLVEDNAVQSYAHKDEYVDKRVAVLRGRVLS
QQGLGVVGVRVSVDRHPRLGFTLTRHGGWFDILVNGGGAVTLQFQRNPYRPEMRTVWAAW
NRIVVLDKVVLRLGDSSDNLASGSAGDRNSKQSSDKPQCQIDELEMIQPSVLNAQDAEFH
HQSGDGQLGLLLADKQVLQEVVPIPGLPDYKLVYRSENALNYHSLLRLQLTSAQIPTQLG
YVHLRLIVEGTASEVTLEAEANLTYAFAWDRHNVYGQKIHGKTEAYVHVGYQSSFDGCLT
SWQTLVAPMAGFAPNISALGEFNVDVHHHFIAGQNVLFRGDGGQMDLRSGPRQLSLTIGT
GSPRSLTCVECQSASPSAYAKILNPVAMASAGDGSLYVGDFNLVRKVTPEGRVFTVLHLP
TGQVSYSYYLAVSPIDGSLYLSDCERKQILRVTAVSEEQLLNPSSPSSLAGLDNNYEVVV
GSGEPCLPADPEMCGDGRPALEARLVFPKGVAVSPDRILYFADGTSIRYVDGSGIIRTLV
GRPANPIYGLHPAPCNAAVRPTQIQPLWPTQVALNPIDNTLHWIDNNVVLKLTASQFVQV
AAGQPQHCAAQSATPFTSGSHIAGFAFGPAGQLYLVEKPGVNSTRLIETDSSGRSEPLKC
ISSDSTLPCNIPTSISSMAVSPDGAVYVADKQLLQIFSLDYVNPQPDPLSGEYSINWPSV
GEVLVFNRYGQHVTTKEPISGNIKTTFSYTRNGPSGRLMAIIDSRGNKVDFVRESGGDQL
IQAIETSAAVKSHLTVSRMTGSLTHINSSNNCFTLFDYDSVSKLLVGRTESDGLTTIYRY
DQHGRLVQTVLPDGERYTFDATPTSTAIRISLERDNPVELTISGAAIQSGEKKVLYNLMK
NGSSVMEWAGDNQYSFQPLQQGGSEGWSERLQLSGGSAIRGEWATSLQVGSSGSRSQDKT
IRINGAKFLVAEIDGQSGGRQLYDNDRQLVMGFHCDTQGHLKELRLPPGFHGIRYNYDGN
GRLQSWVWGQRQEVYSYDTRGLLAETRSRSDAGNSGSRTIIYGPNDVPTKITLASGRSFS
YAYDESGGLKSLTLPSGNGRHSFSVQPSMGYYKLVYLPPGSSTSTTSQNAYVEHYDSEGR
KLLAMFPGESGRIVYRYRGSQLAEEVCGDRRIDYSTEDDGVTTTTTVTEREFESRTDVTV
NNAELILEDKTDYGAKTGLAGFKFVYGYDSLLRPSSIKGRIGGQILPDWPLSYQIKTGSL
EQMGQFKISRLRPNETSYFDGTAIFTRTLNPHLELSASSLTLHNEEVFRMELSYDAAGRI
NQTRTYTRYLGLKSYVNIKNLTYDADGQLASVEAPESWRFGYDQHGNLAKLTYRGNSIPM
QHNGFDRLVKFGEGAYQYDDAGNVIQNAREEKFQWSASGLLIRAQKKGMFDVRYFYDHQR
RLVGRRDQHGNVTQFFYANPQRRHQVTHIFSPRDLRLTTLTYDEFDHLMHFQILRHRYYV
ATGDRCGTPSVVFSQKGEVVRELVRSPYGHVVYDSNPYLYMPIDWCGGIADPATGHVHVR
GDRIYDPLIGQWLNPEWQRATKMTYQPELVHLYRLPGNDPVNLDAFGLSGSHRLSHTSRY
PQWLSRMGYQLPTIRSRYQEDNSALVAGKSIVRQPPILTTSRLLELNLRRKSLHEFADFA
SKCSTPNADQMELNEIRFALAPSTLGRGILVSRSSDGRSIVSSTSLADPVIRDVFTNVFN
NSRWLNLTLPGHGHGQDTFHFFKRGDNVRIKVAEDMAALRRLGPNVNLTMHDTPDTGAKE
IKIATGHGNFVVIYGTDLAAETELLWRHSVKLAARRAWHREQILARRGGINTFLMTQSEM
EQLSRDGHLPNYRPELQQSLWNYPLLADDPTAMRFRKRNAAGSSSLDVPRR
Download sequence
Identical sequences E9FYZ3
jgi|Dappu1|42869|e_gw1.5.2.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]