SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|43397|e_gw1.6.377.1 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|43397|e_gw1.6.377.1
Domain Number 1 Region: 1315-1574
Classification Level Classification E-value
Superfamily YWTD domain 1.83e-50
Family YWTD domain 0.00000368
Further Details:      
 
Domain Number 2 Region: 3107-3367
Classification Level Classification E-value
Superfamily YWTD domain 4.19e-48
Family YWTD domain 0.00000223
Further Details:      
 
Domain Number 3 Region: 2275-2536
Classification Level Classification E-value
Superfamily YWTD domain 9.42e-45
Family YWTD domain 0.0000133
Further Details:      
 
Domain Number 4 Region: 601-835
Classification Level Classification E-value
Superfamily YWTD domain 2.09e-39
Family YWTD domain 0.0000306
Further Details:      
 
Domain Number 5 Region: 1973-2212
Classification Level Classification E-value
Superfamily YWTD domain 2.62e-36
Family YWTD domain 0.0000453
Further Details:      
 
Domain Number 6 Region: 243-497
Classification Level Classification E-value
Superfamily YWTD domain 6.54e-34
Family YWTD domain 0.0001
Further Details:      
 
Domain Number 7 Region: 1657-1900
Classification Level Classification E-value
Superfamily YWTD domain 9.81e-34
Family YWTD domain 0.0000859
Further Details:      
 
Domain Number 8 Region: 3967-4234
Classification Level Classification E-value
Superfamily YWTD domain 1.2e-29
Family YWTD domain 0.0000871
Further Details:      
 
Domain Number 9 Region: 131-233,516-571
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.05e-16
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 10 Region: 70-110
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000209
Family LDL receptor-like module 0.00072
Further Details:      
 
Domain Number 11 Region: 935-976
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000484
Family LDL receptor-like module 0.00069
Further Details:      
 
Domain Number 12 Region: 974-1013
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000353
Family LDL receptor-like module 0.00077
Further Details:      
 
Domain Number 13 Region: 2620-2662
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000471
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 14 Region: 2928-2967
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000511
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 15 Region: 3454-3494
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000694
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 16 Region: 1018-1056
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000982
Family LDL receptor-like module 0.00093
Further Details:      
 
Domain Number 17 Region: 1581-1619,1909-1945,2530-2593
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000135
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 18 Region: 1054-1096
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000196
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 19 Region: 2886-2920
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000236
Family LDL receptor-like module 0.00064
Further Details:      
 
Domain Number 20 Region: 2584-2622
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000262
Family LDL receptor-like module 0.00089
Further Details:      
 
Domain Number 21 Region: 3540-3577
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000589
Family LDL receptor-like module 0.00089
Further Details:      
 
Domain Number 22 Region: 3497-3535
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000798
Family LDL receptor-like module 0.00066
Further Details:      
 
Domain Number 23 Region: 2750-2788
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000812
Family LDL receptor-like module 0.00089
Further Details:      
 
Domain Number 24 Region: 2794-2830
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000929
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 25 Region: 3882-3939
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000118
Family EGF-type module 0.013
Further Details:      
 
Domain Number 26 Region: 3027-3065
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000153
Family EGF-type module 0.024
Further Details:      
 
Domain Number 27 Region: 3793-3828
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000262
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 28 Region: 3666-3703
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000301
Family LDL receptor-like module 0.00086
Further Details:      
 
Domain Number 29 Region: 2708-2747
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000314
Family LDL receptor-like module 0.00076
Further Details:      
 
Domain Number 30 Region: 2976-3014
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000419
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 31 Region: 3051-3099
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000453
Family EGF-type module 0.0078
Further Details:      
 
Domain Number 32 Region: 1142-1179
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000589
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 33 Region: 900-934
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000628
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 34 Region: 3751-3786
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000681
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 35 Region: 3707-3745
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000733
Family LDL receptor-like module 0.00088
Further Details:      
 
Domain Number 36 Region: 3837-3874
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000785
Family LDL receptor-like module 0.0025
Further Details:      
 
Domain Number 37 Region: 1186-1222
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000812
Family LDL receptor-like module 0.0027
Further Details:      
 
Domain Number 38 Region: 1103-1139
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000864
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 39 Region: 3416-3453
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000105
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 40 Region: 32-70
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000122
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 41 Region: 3623-3661
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000275
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 42 Region: 3575-3619
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000484
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 43 Region: 1269-1310
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000558
Family EGF-type module 0.0061
Further Details:      
 
Domain Number 44 Region: 2661-2695
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000011
Family LDL receptor-like module 0.0021
Further Details:      
 
Domain Number 45 Region: 2838-2879
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000458
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 46 Region: 1231-1275
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000724
Family EGF-type module 0.021
Further Details:      
 
Domain Number 47 Region: 3371-3415
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000739
Family EGF-type module 0.012
Further Details:      
 
Domain Number 48 Region: 1-27
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000128
Family LDL receptor-like module 0.0029
Further Details:      
 
Domain Number 49 Region: 4287-4322
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000904
Family EGF-type module 0.015
Further Details:      
 
Weak hits

Sequence:  jgi|Dappu1|43397|e_gw1.6.377.1
Domain Number - Region: 843-888
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00247
Family EGF-type module 0.012
Further Details:      
 
Domain Number - Region: 4240-4269
Classification Level Classification E-value
Superfamily EGF/Laminin 0.067
Family EGF-type module 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|43397|e_gw1.6.377.1
Sequence length 4507
Sequence
SGICLPPEKKCDGFLDCRDGADEAGCTFAANVTSCHLDKFRCANGWACLETSRKCDHRSD
CADGSDEVDCNFPACHSGQFRCDNGLCFPNRWRCDGFADCGDNSDEANCTLIGCPDNKFL
CPQGSPTGGPKCVERTKLCDGHGDCSDLADEKVECSNHLCTSIGCAHQCRPSPEGGICIC
AEGQVLSTTDNRTCSDRDECKEWGFCDQTCTNVERSFECSCQDGYELIDGNQCAASNASQ
FRLYFAHHQRVVKIDATGQSIETVSNSTSAGGLDYHFRRGMLLWSDLETRKIYSAPLDSS
LGQDKPPSTTGGGGASSRESRSSSSSDISVPTAWLPVAIAVDWIGDKLFVADALGQKIDV
FELDGRWHAIVISNNMSEPTDLALDPTQGVMFVSENSRIFRANMDGSKMKDLVTDAIYKA
SGLAVDLPTKRIFWCDSLLDYIETVDYDGKNRFLVVRGAANVPAASRLAVFERSVFWTDG
TKQGVLSVSKFKGESTIQTIYRMRNVTREPKAIRAVHRLLQPQLANPCGTNNGGCQHMCI
VSQRADGQGLGFRCACNIGYRLADDRMWCSPVEDFLMYSQQKFIKGRVILPVSEGFDDAI
SPIVSRTARFVGLDFDSYDDHIYYSDVILDVIYRIRRNGTGRENVLASQNEGVEGLALDW
ASKNLYYIDSRKGTLNVLNTRNSTYRRTLLRDLKRPRAIVVHPNKGFIFYSEWDRPANIS
RAYLDGTHLMVFKNILLGWPNGLAIDFETDRLYWCDALLDHIQHSKLDGTDVRTISSRLV
RHPFSLVVFKDIIYITDWRLDGIVRMNKTTGESEKVIIQVQENNRLYGIKVYSKQTQNII
AGHPCATNNGGCEKLCFPIPSNLTTSGLTPECGCPYGEKLSPDRKTCILDPGSEPPVQAC
PNIWDFTCDNQRCIPKTWVCDGDDDCLDNSDENQNCTKPTCSTDEFQCTSGRCIPNSFRC
DSDNDCGDSSDETGCVNVTCDASQFTCDNGRCIPPTWKCDSENDCGDGSDEGDFCAERTC
AYFQFTCPRSGHCIPQSWVCDGDNDCFDNKDEEGCPPITCSAQQLKCGNGKQCVHESYKC
DGIPDCDDGSDEVGCPSLAPDQCNEEKQFNCARSGVCIPRAWHCDGTKDCEDGSDEPDTC
GEVNCGKDYFKCNNSRCVINTMVCNGQDDCGDGSDEDDRHACSRPPFQCPAGQWQCPRVT
DRCINVTQVCDGKRDCPSGSDEGPGCDTKDCEDHGASCSNGCMQTPAGPLCLCPPGEVLL
ANDTKACVDLDECQFPGSCSQSCRNTKATFICSCSEGYLLEEDKHTCKAINSSSAFLLIS
NRRSLLVSDLKEKSIEVVPVEVENVVALASDTHSNVLYWYDMKTKKIFRKELSGTPKVII
SSGADLIEGLALDWIAQNLYWVDSRLNTIEVSRENGSNRMVLLSKDIDQPRGIALDPSPD
ARVLFWTDWGDHPRIERVNMDGSNRTSILTSKIFWPNGLTLDLPTKRVYFADSKVDYIDY
CNYDGSGRRQVLSGSHYLLHPHSLAVFEDTVYWTDRQLNRVLAANKFTGQNQTVFSHLVS
QPLSVLLHHPALQPLSPNPCANATCGHLCLLSPVSPTGYTCRCRPGYRLNPLGTTGQCIE
EESPYLILMKGSQIIDLGLTPNSDSDSRGGRLTPVVEVGAGRELDFDRKGEAMYWIEVLE
GDEENGTLYKMNLGGGNKTSFLSDLDTGIVGAPYTLAFDWVGRNLYLGNKKASNIEAIRV
DGKTKHRTVILSNDGTDVSVAKPRAIALDPYEGKLYWLDEGGFGIPRKISKANMDGTEVR
NLFTDIGQPLSLTIDLANKQLYWSTINEAEIEASDVEGNNRRKIISSGINKPVSLAVFES
RMYYLDTVYEEVARVDLPNGDNKQILKNNQPDLKTFRLYHKRSTPDNHPCAINNGGCEHL
CIPSASNTRVCRCSLGSRKDGETRCVPYKSFAIVSQLTLTRGFSLEDSAAEGMIPITGLG
HNILHVDVHCADNWIYWVEFNKDKLNGIFRIRPNGSELTHVVSSGIGSNGIRGLAVDWLA
GNLYFTNVFPHETYIEVAWLDGSKRMELLRSTKESPRELAVNPIKRFLYWIDNGQFPVIG
KALLDGSQWTPLVTSGISSPRDLTVDMQTHDVYWVDSREDAIQRISYTGGNRQLIRRNLP
NPMGIALLKNTVYWVDRNLGCVFRASKQPGNTTLPEKVKTGLDNLRDVAIFDISNQPQGE
TPCTKTPETGGCEQLCFAYPTDSMTPSPSLFGFQCKCATGSLQEDGRTCGTPKEYLVFAT
RTEIRSVSLDPKALSAPFAPLVNLSNVVGLDFDFADHRLIYTQIRPDARIAWYNSENPSA
SNATLIKSGPINPEGIAYDWTHKKIYWTDSANSSIYAMNLDGTQVVNIARVDRPRAIVLH
PCRGYMFFTDWGRFGPNGKIFRATMAGTMKEAIISQDLTQPSGLAIDYDDDMLYWTDAVR
EKIERSNLDGTNREVLITATIYPFAITVFGNFIYWTDLQLRGLYRAEKHTGADMIELVRR
LDDSPRDLQVFSPERQRCQFNPCTFNNGGCAQSCHPSTNGTSECKCDESTKLVNDNRMCV
GRNLTCEGNKFYCANGKCISRLWACDGDDDCGDNSDEDKGYCSFHTCGPIEYRCGNGRCI
FKSWKCDHENDCGDNTDEDGCTYASCAEGEFTCANQRCISMTQVCNGINDCKDANTTDEA
SDRCSRNTTCPSNHFKCNSTNICVEPFWLCDGDNDCGDNSDENDSACTQRSCPSNSFRCP
NNNRCIPATWYCDGDDDCGNGADEPPDYCKSGTKTCFGDLFTCDNGNCIPRIYICDGDND
CLDNSDEDNRHQCGSRKCDSETEFSCSANKQWGKAQCIPRKWVCDGDPDCVDGADENSTL
LNCTSRNSCSAEQFTCGNGRCIHRNWTCDHDNDCGDGSDEGPECNGKYRTCSPTEFACQN
AKCVAKSYHCDKENDCGDWSDEWNCTYSGGKSGSTPVATCPDGQFKCANSSQCIDESLVC
NKVSDCPDDSDESHLCGVNECLKVEVHQCGQLCIDAPIKYKCACNPGYRLMADGKACTDV
DECTDTPGVCSQYCVNSPGSYYCKCNETYYEREADEHTCKRKDSITPWLVFTNKFYVRNM
SIDAKQYAVVHQDLRNVVAVDFDFREDRLYFADVNAKTIYRAFVNGTSTKETIIKHDSMG
LEGLAVDWVGRKLYWLDRHSKHVEVSELDGTHRKTLKADGISDPRAIVVHPGAGYLFFTT
WHLQAYIGRLGMDGSNFTRIVTYEQRLAWPNALTIDYMTDKLYWADAHLDYIAYSDLDGR
NRRYVVQDTLKVPHVFAITVFDDFIFWTDWNLKAISRANKWTGENYTVLRNTTHRPYDLH
VYHPLRQAAYPNPCGKNNGGCSGLCLLSPAKNGTVGFKCVCPNQFILAPDGKNCIANCTA
GQHRCGGKDNRCIPLYWKCDGEKDCQDGTDEPSSCLERFCKSGQFQCKNHNCTTATTLCD
GVDDCGDGSDEKDCDIPCPENEFKCNSTGRCILGTWKCDGDNDCRDGSDEDPAICHSRPC
DTDTEFACKNGRCIQKSWYCDSDNDCGDGSDEPAHICRQRNCTAGWKRCPQWGNYRCIPQ
WLFCDGKDDCRDGSDELPEQCPKCHETAEFQCKNKRCIPRRWTCDFENDCADGDDEDEEL
CRHQYRECSASEFRCASDGKCVPGRYRCDLDSDCTDGSDEMGCEGFTCTNGTFQCKSGHC
ISKHFRCDGERDCHLDASDEADCPPRYPDGKYCPPERFECDNHVCVNVENRCNGVNDCGD
NSDEKPEECSDKCGGRDRFQCDNRRCILRWQICDGHNDCEDGSDENNVTLCAKRPKPCNP
NEQFTCANRNCVPKELVCNLQNDCEDESDERGCHSASSCTDSSNGGCEHRCQNLTGGGYI
CSCNRGYIASKENPKICEDVDECATLQHNCSQICINLKGSYKCGCHSGFDSVDNVSGVCK
SPGPWNLLFSDGSNVISLNTTQRKEREVIFGEKRIQSLDFDPHSHIVFWTDPMDLSIKRS
YIPESSNQVEIGHPQVIVSFTKTAVPVDLSVDWVAQNLYWLEMDGQTSKGQVVTAKNDGR
YRRSVVPRGIDTPTSIVVNPILGELYWTQAGSNPRIEMSWMDGTKRKVLVSERLAHPTAI
TIDFSMDNTIFWADHTLSTIEMMKRDGTGRTTVLRGDNIDRPSSLDVFESTLYWISTGKG
ELRRQDKFGRGVMVRLVKDIATPSTVKVFSEYRYNTTVSNPCLNSPCTHLCVLIPGGYRC
ACPDSTIQVQTGGEVSCDTTQERPRPSPLRCPCQNRGVCTGDGQVQCQCPNDYEGVHCET
HLLRRPTPSESVAPAYIIVPILLIILAGLAGAAVYVFFFRRSGRAKGSGFTGFGGSPSVS
FRQGTNVEFGPASFSGNGSNASTMEPVDSEFNGRDASIKSRDFSNPMYDAVGGPVETPKG
GIYEVPAEMIKGMPLSSDPVPGSAVISPSSIVHQASPQIHIRHRELDPSNVDTGKDTQKL
VEDTSDC
Download sequence
Identical sequences E9FZA9
jgi|Dappu1|43397|e_gw1.6.377.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]