SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|44521|e_gw1.7.344.1 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|44521|e_gw1.7.344.1
Domain Number 1 Region: 87-127
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000945
Family EGF-type module 0.0052
Further Details:      
 
Domain Number 2 Region: 2-129
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000628
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 3 Region: 165-202
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000013
Family EGF-type module 0.012
Further Details:      
 
Weak hits

Sequence:  jgi|Dappu1|44521|e_gw1.7.344.1
Domain Number - Region: 125-160
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000192
Family EGF-type module 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|44521|e_gw1.7.344.1
Sequence length 253
Sequence
PGYEGKFCEEQFNACDSMVCHNGGSCLIAHDGRAHCSCSSGFVGLHCEEELTGCDSSPCV
HGICVDQTHGYRCFCQPGFGGPECNFEYNECESNPCSNGGTCLDRVGEFQCICPSGYAGS
RCETQVNLCEPNPCGLNQKCIDHGTNISCECIPGLDLALCAEMNSACHPNPCLRGGTCWV
SSGSFFCACKPGLTGDRCQGEQHSVHLYQVLWGCFVALFILLFAAVTLPPFFYMYVHLIL
TVARRCYSMRRYY
Download sequence
Identical sequences E9G1P9
jgi|Dappu1|44521|e_gw1.7.344.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]