SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|46372|e_gw1.11.43.1 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|46372|e_gw1.11.43.1
Domain Number 1 Region: 38-138,183-433,532-590,620-648
Classification Level Classification E-value
Superfamily MFS general substrate transporter 1.57e-24
Family LacY-like proton/sugar symporter 0.038
Further Details:      
 
Domain Number 2 Region: 444-492
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000222
Family Ovomucoid domain III-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|46372|e_gw1.11.43.1
Sequence length 687
Sequence
MANTVTNAKSSDPASTADFDDGGGQCGWCCWKPKFLQRLSTSKSFLFWICWAGGFQSFLI
NGLLNVCVSTIERRYDLTSTDSGMIIGCYDIASFLTAMSYLGGRKGACKPHWVGYGVLLL
GIGSFVFATPHLTSGLYQASVKEQVINTCSLSVPSVNASCSTSDQLTAGLTGGWALQKFK
YVFLVAQLIMGAGGAPLYTLGTAFIDENVSHKMQPIYSGIFYGSTMLGPALGYIAGGQLL
RLYVDFDTISANEVGMAPGSSGWIGAWWLGFVIAGTLLCIAAIPLLAFPGELLGDFIQCY
NNSRRFVDHIVSFCLFLRELPLAIKELATRWTFLFICLEQSCEAMLLAGFGAFLPKIIES
QFSLSPAMAAIIVGGLVIPCGCGASYSGGYLIKHYRMRPRTILKMSCFWVSLSFIFSLAF
MVYCPNQDFAGVTIPYSGKHELKIVSDCNAKCSCSLDTYDPICGIDNILYYSPCHAGCTS
SHETLVYSNCSCISSPEYKRMKVMGGAEIDVMAARQTCTSAKCNHQLYLFTILLFLFLAL
VFMNSMPILSATLRSVPYNRRAFALGTQMIIWRLLGAIPGPMIFGLFIDSSCVLWSHTNN
ECGDNSDNSGSCLIYNNYSFSRAMVGLALVVKGFTFFFATLAWWFYTPPIVTKASNGVQE
VAATSANPEAKTKEIYAYDNTAVDRNE
Download sequence
Identical sequences E9G6H1
jgi|Dappu1|46372|e_gw1.11.43.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]