SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|47122|e_gw1.13.181.1 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Dappu1|47122|e_gw1.13.181.1
Domain Number - Region: 58-180
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00243
Family Growth factor receptor domain 0.0038
Further Details:      
 
Domain Number - Region: 554-655
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0235
Family Growth factor receptor domain 0.0033
Further Details:      
 
Domain Number - Region: 278-328
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0419
Family Laminin-type module 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|47122|e_gw1.13.181.1
Sequence length 759
Sequence
MSLLPSPHQQQWGTLLLLVWLAQLCQASTLSGSNICTRQEKYFVTVKISYLQPYKVRTFT
TCLAFPPWCSRYTVHNKVAFKTESVEKTRVLEDCCSGYARTADNSSCVPICGQQCLHGTC
VGPDNCKCEPGYGGPTCNIACPEHKWGPNCSNSCPCLNGAKCDPVNGSCTCTAGWKGLHC
DYPCPKNYYGQSCSLKCQCKNQAYCDPVSGACACQPGWNGPLCDEPCPDGTHGQNCASSC
RCQNGGTCSPIDGKCFCTSGWTGEVCANPCPDGTWGAQCSQRCSCHNNARCDHINGSCHC
LPGYRGDQCQEQCPPGMYGKNCETPCKCQNGAICNITNGSCACTEGWTGPDCGQRACSDK
LYGPGCTQICPCSSNNTELCHPWTGECICKAGWDGQTCSRPCPTYTFGLGCRNVCTCKND
AHCDPVNGTCVCLSGYIGNDCQDQCPEGRYGHNCTNVCACENGGNCSNTDGQCKCPIGWS
GLLCESPCRAGFYGEHCKEQCHCKNGASCHHVTGECSCSAGFKDDACNATCPEGRFGLNC
EETCECQKGTTKACDPVTGECLCRTGYRGVRCETQCPKGRYGPECRDVCHCENDGSCDNL
GDCFCQRGWTGELCEDRCPTGFYGKKCRQPCPSCVNGEFWLSTSFRLLFSIIYCVLFFFL
FLSFKVTDNVIRLTAVVLASRVTWEYDARSPALKVFNYLACLMDRWRHLIYISYTLCSCL
SGTYGEGCQQKCNRCKNGAECHHVTGQFSSIHMLNVNKI
Download sequence
Identical sequences E9G8Q8
jgi|Dappu1|47122|e_gw1.13.181.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]