SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|48903|e_gw1.17.285.1 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|48903|e_gw1.17.285.1
Domain Number 1 Region: 96-218
Classification Level Classification E-value
Superfamily EF-hand 3.91e-40
Family Osteonectin 0.00055
Further Details:      
 
Domain Number 2 Region: 30-91
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000738
Family Ovomucoid domain III-like 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|48903|e_gw1.17.285.1
Sequence length 229
Sequence
EAALKDNLCAKKHCGAGKECRVNQMGAAECVCMDHCPEEKDPRRMICSNQNETWNSDCEL
YRMRCLCKSGSAGCVDSKYDHAHVEYFGTCRDVLQCTADEMADFPRRMRDWLFNVMRDLA
DRHDLSPHFLKLEREAEKDNSRRWANAAIWKFCDLDGHPHDRKVSRHELFPIRAPLLALE
HCIQPFLDGCDADNDHFITLQEWGTCLELTEEEIEDKCDDVRDEAENGL
Download sequence
Identical sequences E9GCX1
jgi|Dappu1|48903|e_gw1.17.285.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]