SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|49862|e_gw1.20.118.1 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|49862|e_gw1.20.118.1
Domain Number 1 Region: 617-659
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000746
Family EGF-type module 0.0043
Further Details:      
 
Domain Number 2 Region: 474-516
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000219
Family EGF-type module 0.0062
Further Details:      
 
Domain Number 3 Region: 363-405
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000067
Family EGF-type module 0.0062
Further Details:      
 
Domain Number 4 Region: 604-735
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000251
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 5 Region: 739-777
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000237
Family EGF-type module 0.0071
Further Details:      
 
Domain Number 6 Region: 439-483
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000419
Family EGF-type module 0.0052
Further Details:      
 
Domain Number 7 Region: 271-316
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000042
Family EGF-type module 0.012
Further Details:      
 
Domain Number 8 Region: 399-438
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000237
Family EGF-type module 0.0078
Further Details:      
 
Domain Number 9 Region: 787-844
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000356
Family VWC domain 0.028
Further Details:      
 
Domain Number 10 Region: 515-558
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000566
Family EGF-type module 0.0092
Further Details:      
 
Domain Number 11 Region: 313-367
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000141
Family EGF-type module 0.01
Further Details:      
 
Weak hits

Sequence:  jgi|Dappu1|49862|e_gw1.20.118.1
Domain Number - Region: 560-568
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0152
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|49862|e_gw1.20.118.1
Sequence length 1186
Sequence
SASGFFELEVVALQNPQGRLANGQCCGLVAGEETSSTCQRECATHFRLCLKEYQSNVTVS
SPCTYGNASTPVLAGNSFTFVEPDKSNARLVIPFSFRWPRSFTLMLEALDYRNSTRQSGE
IERAVYSGILEPSADWHSLTHEGSGVNSDLRLTYRVRVQCEPHYYSATCTKLCRPRDDLF
GHWECDRNGDKTCMPGWTGTSCDTVVCKAGCHPINGDCKEQPLECRCRPGWQGEFCDQCV
TYPGCKHGYCNGPFQCLCETNWGGYLCDQDLNTCGTRQPCRNGGTCENTNPDQYQCKCPE
GFSGINCEVVDNVCATAPCLHGGTCTVTTTVVTNGISDSTGGGGSFNCTCPPGWTGDTCQ
IKVDECQSSPCLNGATCVDLENGYRCQCAQGWQGDTCDQDVDECSMPELCRNSLGCENTP
GNYTCRCVTGFHGRQCQYNVNDCNGHHCLNGATCIDLIGEYHCACRPGFNGHRCEINMDE
CASRPCANGGECVDLVDGFKCICPLGYTGSQCQTDTDLCHPNPCANGSPCFNTLGPLGGP
DYFCLCQSHWQGKNCSRYRPPPPPPPPPSSPSLQAGSCWTSKGAGHCVHGRCVASEDGST
FSCQCDPGYSGQFCTDNVNDCADSPCRNGGTCIDGIDSFHCVCPKGYDGLTCDHNVDDCA
SSPCRHNGTCVDLVADFVCRCVDGWKGRTCSNRNQHCQDGENPCLNGATCVDDSDPEAGF
TCRCSSGWKGSICHLAEHMPCDAHPCRNGATCLNTGQSFTCVCKDGYEGQHCQMEQRQTA
AAAASTTTSPASCQWSGRLYPDNSSWDDGCNKCQCRSGQAVCTRVWCGPANCLDDPINHV
GKSCGPSEICLSAQSGCLRPPCPAYGQCRPLKPGRLLPVPAATASCWPNLTGNRLAPTCA
RLTLVLDRYRAQPGFSVQSLCGHLRKLAAAQSHLWDNFPGHQQPNLERPSLVILCDLKDH
QDDVVQVTIVRSRATAAARVLGNVLTAYYKEGSSMGAVVDVKVETPYADEIELVLDSSSA
QNHPSSDSSGSSNYVVAIVCAILAGLVVVAGLLLLLLWRLRKRPALHSPSLSVNSSMDRT
VEKSNNLQNEENLRLQQRRIKTLNVAELVDHPAKGSLGLSKKLSKVDDVVVPHDDSSSDE
YGRRDTIESSPIYKAPISVDVRNNIHMAARAGQMMDKELSLKVVVV
Download sequence
Identical sequences E9GFT9
jgi|Dappu1|49862|e_gw1.20.118.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]