SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|51037|e_gw1.24.139.1 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|51037|e_gw1.24.139.1
Domain Number 1 Region: 95-204
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.1e-23
Family Spermadhesin, CUB domain 0.00079
Further Details:      
 
Domain Number 2 Region: 501-624
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.7e-20
Family Spermadhesin, CUB domain 0.0012
Further Details:      
 
Domain Number 3 Region: 366-492
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.62e-17
Family Spermadhesin, CUB domain 0.00045
Further Details:      
 
Domain Number 4 Region: 226-351
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000000034
Family Spermadhesin, CUB domain 0.0026
Further Details:      
 
Weak hits

Sequence:  jgi|Dappu1|51037|e_gw1.24.139.1
Domain Number - Region: 1-68
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00123
Family Spermadhesin, CUB domain 0.0059
Further Details:      
 
Domain Number - Region: 640-674
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00288
Family LDL receptor-like module 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|51037|e_gw1.24.139.1
Sequence length 771
Sequence
CSHEYIDLYTEIPDSEPVDLIHSPFGGRYCGQIPPRRRVSLYRTAVLGFFTDKNSTTSDD
LLFQGTYLFFKDDQFQVGTPVPRTTCNFTIDGLVKRQGDIMTPTYPGVYPKDMTCAYKFV
GKKGQRIRLEFRDFDTFYGGPHCPLDAVDVYDGLDAKAPLIGRYCGQQRNVVIFSTEHHL
LVTFTTLKRTADSQNRGFLAKFEFSETFVKLDFISREDSKHDRGSECDQTILSRKGSSAV
VYSPNYPFPYSPGIVCKYNVYGLQDEQHFERIRLDFEKFDIPSADNTCADGFLRIYLKGQ
DISVTYLYEKHDHELCSNNVSSPYWSEGQRLSMIFSSGQSQGSGFKARFLFATEYSIPGT
PSPLGGCNFTYMSLSKKRGDFNSPRHPARYPSNLTCTYNFILAGSNENVRLYFDQFKVRA
NDTTVFYGSYCQEDWVEIYNVFYGGREVLLGRYCGDSFPGPVESDPGSIGLKVILHTDEE
GVFNGFKGRYTFDENDSINRDCGSNLSVPGAASGVFTSPKYPEKYDRSSGLLSCSWQIHS
ARDHRILLHFESFSIEGEMETRGCAAAAVRVWKRLDEPPVEICGENLKAEHETFMSEGNV
MKITFTTADKVAGGRGFRAVWTEVKTPALVGGYDCDEGGQYFRCANNTFCIAKQLECDGN
PNCGLNDNSDEGEHCAAMVGGEESSPVLLMLTLGACALTLLMTLCIVCHRRQRRRPPSIN
YERRPFAPPPPFDTMSSRPSMSLPSDIPSPPPPAQLYTSLPPLSIDIGDNV
Download sequence
Identical sequences E9GIQ2
jgi|Dappu1|51037|e_gw1.24.139.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]