SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|51694|e_gw1.26.41.1 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|51694|e_gw1.26.41.1
Domain Number 1 Region: 518-616
Classification Level Classification E-value
Superfamily Kringle-like 5.32e-33
Family Kringle modules 0.00029
Further Details:      
 
Domain Number 2 Region: 6-111
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000533
Family I set domains 0.06
Further Details:      
 
Weak hits

Sequence:  jgi|Dappu1|51694|e_gw1.26.41.1
Domain Number - Region: 358-448
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 0.0112
Family Frizzled cysteine-rich domain 0.01
Further Details:      
 
Domain Number - Region: 222-248
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0146
Family I set domains 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|51694|e_gw1.26.41.1
Sequence length 721
Sequence
VQDGPVETVEAAVGHGLTLQCHLPDVANVSSAVTVRWERWATYHGAGPDANESKPRTGES
LVVARRRRRRRHHHHHHRRRSRRLIHQGSALRFASISEADEGLYRCVGSSSSSSSFIDST
SVDEGGRGELDDPRSLILDHPDADNVTIVSAINDTEQQSGVVTSPSTDDGGDGGDDPRVV
TTSTPSSTPVYGSFIYLRVQVAAVLTDYPESPVLIHPLRQQRRKQRLKCLAFGHPTPVIH
WRINNNESLHQQVRLVEEADDEPIRRPQRGYIRSVVAIDWESSRQGDQENDQDQDQDDDD
DDNNWQQTVNVTCSASNTIARQTHTDTRMFNLERVRPGDVRGEQEDEANDNQAGAGYCGR
YTGNICRGQLSNPASVWYNISSNDQTGGWLNEQLVHGLWDEVVNTLREPCKSAAKKLLCL
YAFPECHLDEDGFARKLPLCYEDCMATRQLFCVDDWAQLESNKQRGFYLGSRGHFRLPKC
EKLPRIGSRSFFMSSSHSGSKYGQDPPSCSRAHLTQLVPAEVTTSCIKGRGRFYQGNVSV
TRDGIACQRWDAQEPHSHNRPPLNIFPEMQGAENFCRNAGGEEPRPWCYTTDPLVRWQPC
DIPQCGHSEVEVTLLPMEATFTPGFVLLLAGVGFLSLLIFLLFLLLCQRAFKHKQGYQLP
SLQKESIDLQKLRDNSTYQCVGARIDPSLEKLEYPRNDIIYIRDIGQGAFGRVFQVSATR
N
Download sequence
Identical sequences jgi|Dappu1|51694|e_gw1.26.41.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]