SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|52810|e_gw1.32.57.1 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|52810|e_gw1.32.57.1
Domain Number 1 Region: 1-107
Classification Level Classification E-value
Superfamily C-type lectin-like 8.75e-26
Family C-type lectin domain 0.00092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|52810|e_gw1.32.57.1
Sequence length 108
Sequence
NWTAAQEFCRKNDMFLLSLETQNETELINNHIKNSGLPKDFYWTSGSDEANEGQWIWTST
QENITVTNWRNNQPDGGKKENCLYLHSRDEFKWGDWMCNLSQYFICEW
Download sequence
Identical sequences E9GN73
jgi|Dappu1|52810|e_gw1.32.57.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]