SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|52974|e_gw1.32.142.1 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|52974|e_gw1.32.142.1
Domain Number 1 Region: 27-132
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.85e-32
Family Spermadhesin, CUB domain 0.00037
Further Details:      
 
Domain Number 2 Region: 142-263
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.8e-17
Family Spermadhesin, CUB domain 0.0033
Further Details:      
 
Domain Number 3 Region: 274-313
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000733
Family LDL receptor-like module 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|52974|e_gw1.32.142.1
Sequence length 370
Sequence
MSQIKDPVEASLEDVRCYNFSVGMPPRQEFYSPGHPANYPAKVDCLLVLKAEPGFVIRVD
FRDMFDIEPHEHCLYDFLEIRDGAHGYSTLVGRYCGRTFPPVITSSERHLWLRFTTDDNI
EYTGFRAVYQFLPDPAPRIPDQGSCRFQVTGLDGTFSRSDVPEEMVNHSRDFQVPLDCTW
VITVAETHKIQLSFPSYALMAPNECDLNFIEIFGEMTDLRHRLRLFCGSKIDIVLSKSNI
LHLRLFAHHTALRSTFEALFTAVTLYRETEGTAKCIASEFDCEDAVCIDSSLRCNGRVNC
KFRYDEENCKVVRKKVMSSDHIIVILTIFCLTLFGLCFSCFFNCIRKLRADHTDYQVLSR
FICFLDSFNV
Download sequence
Identical sequences E9GNF4
jgi|Dappu1|52974|e_gw1.32.142.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]