SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|54555|e_gw1.42.119.1 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|54555|e_gw1.42.119.1
Domain Number 1 Region: 38-126,171-409
Classification Level Classification E-value
Superfamily MFS general substrate transporter 9.55e-24
Family LacY-like proton/sugar symporter 0.08
Further Details:      
 
Weak hits

Sequence:  jgi|Dappu1|54555|e_gw1.42.119.1
Domain Number - Region: 435-482
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00051
Family Ovomucoid domain III-like 0.018
Further Details:      
 
Domain Number - Region: 529-633
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.0314
Family Glycerol-3-phosphate transporter 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|54555|e_gw1.42.119.1
Sequence length 695
Sequence
MGKVKNKNKLEEDEEDTQCGLGPFHGKWLQGYANKKSYLLTYSFLGLFQAMFFSYSIATL
TTLEKQFKLKSQTTGILLSGNEVSQILLSLVLTYFGGHGHRPRLAALGVVFSGVASIIVV
VPHFVYGQFATATNVTRSFDVCSTSTDSVMPTMNPEDSCDETAPIGPMIYIFMSQFVSGI
GTTLFSILGITYLDDNVKRKQTPMLIGLMSSLRLIGPVFGYGLAAICMRLYVNLSETTTL
KPRDPSWIGAWWLGFMIIGIIQISTAWLLACYPRRLPKKSTTAVGFMTIAAQKSTQQPNK
PKERTFKEFPAALRRLLTNKILILNNCAGVFFVFALSGYITFLPKYMETQFQQSSSMSGL
VNGLTGILFMCTGLLMAGYLISKFKFHAWKLQVWDVIVGIIWIIILVVFAFLGCDSKPIH
GLENAENGSNAMLGIPTTSCNEECNCQANRFAPACSEDGQVNFFSACHAGCTSMNSTGDR
TVIFINQTSHFNLATDNDFSISNSTLDSGAWYNGKAVGGYCPSNCFQMFLIYISVMGIIK
FLSSFGRVSNILITFRCVPQEDKSFAIGLGYLLTSLFAFIPAPIVYGAVIDQACILWRTD
SCGVRGNCWIYDQEKMRLYLHLLTAGVIVIGVIFDFFTCFAVRNLDLYAEDPVEAGDNGM
VASANNKELQPMLTSRPLPPTNSINEEGFIRTLEA
Download sequence
Identical sequences E9GTG7
jgi|Dappu1|54555|e_gw1.42.119.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]