SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|54646|e_gw1.43.93.1 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|54646|e_gw1.43.93.1
Domain Number 1 Region: 405-462
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000000208
Family Ovomucoid domain III-like 0.0076
Further Details:      
 
Domain Number 2 Region: 51-96
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000652
Family Ovomucoid domain III-like 0.0095
Further Details:      
 
Domain Number 3 Region: 2-40
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000291
Family Ovomucoid domain III-like 0.021
Further Details:      
 
Domain Number 4 Region: 264-305
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000036
Family Ovomucoid domain III-like 0.0091
Further Details:      
 
Domain Number 5 Region: 141-187
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000305
Family Ovomucoid domain III-like 0.022
Further Details:      
 
Domain Number 6 Region: 357-399
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000665
Family Ovomucoid domain III-like 0.041
Further Details:      
 
Domain Number 7 Region: 196-242
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000873
Family Ovomucoid domain III-like 0.021
Further Details:      
 
Domain Number 8 Region: 306-358
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000105
Family Ovomucoid domain III-like 0.018
Further Details:      
 
Domain Number 9 Region: 103-148
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000277
Family Ovomucoid domain III-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|54646|e_gw1.43.93.1
Sequence length 474
Sequence
SCPRFCPKENKPVCGSDGVIYTNECDLYRRNCGLEVETVDDKMCTRSRGSYCGNKCSLDR
DLVCGSDGRTYLNICVLKVETCKRGIRLSHVGPCMNSTALEEPCPQQCSSNDKDGPICAS
NGNVYKSICEMKRHTCGQGVVKTSEKFCQTTSHCKEICWKASKAVCGSDGHIYASSCQMK
VKNCGRHVFEIPISNCIPQERAITNCPAECDSAEPQEVCGSDGNIYGSPCELRMLNCGPN
SDKVIAVDWLRCSGKAARCSQLTCQDDLENPDYVCGNDGRTYPSPCHLRMASCTRGTELA
HVGACMKITPDNSCPESCPDQRESDQPVCGSDGNVYRTQCEMKKQTCGQHVIPVALHHCT
ATESCNSQCDRKVQSVCGSDGKIYRNLCEMRGKNCGKYVYEVPMARCLALAGFRFTGCNR
ICPSEYDPVCGTDRKTYSNECFLQLENCRSRSLVIKKYHGKCGEPVAEPKAYIY
Download sequence
Identical sequences E9GU49
jgi|Dappu1|54646|e_gw1.43.93.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]