SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|61405|e_gw1.100.116.1 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|61405|e_gw1.100.116.1
Domain Number 1 Region: 46-84
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000131
Family LDL receptor-like module 0.00092
Further Details:      
 
Domain Number 2 Region: 127-163
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000157
Family LDL receptor-like module 0.00088
Further Details:      
 
Domain Number 3 Region: 86-123
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000275
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 4 Region: 203-239
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000353
Family LDL receptor-like module 0.0024
Further Details:      
 
Domain Number 5 Region: 9-44
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000393
Family LDL receptor-like module 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|61405|e_gw1.100.116.1
Sequence length 246
Sequence
MCAAPEGECLPNEYRCNSDNTCIPERWVCDGRQDCSLGDDEFACSRCREEEFRCENENRC
LPKRWRCDGSRDCADGSDERDCPSTQECGDGQFRCGDGLSCIPLRRVCDGSNHCRDNSDE
TNCSSIACQIEDFKCNDTGVCISRKWVCDGNVDCKDGSDEAQCAREAELNFESDVLIDEM
EDPLAAGGNETAINADTTFNPDKCPLGELLCMSGSTCIRFEQLCDGTRDCADGADETDCG
KPPGPE
Download sequence
Identical sequences E9HD49
jgi|Dappu1|61405|e_gw1.100.116.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]