SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|61886|e_gw1.108.26.1 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|61886|e_gw1.108.26.1
Domain Number 1 Region: 228-365
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000033
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 2 Region: 396-434
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000393
Family EGF-type module 0.0014
Further Details:      
 
Domain Number 3 Region: 93-212
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000111
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 4 Region: 435-464
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000286
Family EGF-type module 0.002
Further Details:      
 
Domain Number 5 Region: 43-89
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000328
Family EGF-type module 0.02
Further Details:      
 
Domain Number 6 Region: 358-400
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000447
Family EGF-type module 0.02
Further Details:      
 
Domain Number 7 Region: 5-42
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000584
Family EGF-type module 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|61886|e_gw1.108.26.1
Sequence length 465
Sequence
FIPGFVSCSPNPCKNGASCVSNPRGESYCSCPPQYVGEYCQFANPCHTGPGPRCQNGGTC
AVKMSTNAVPSFSCSCPLGYSASLCEIPVPNACDTGPCQHGGTCLLRTLDNYTCACSSGF
RGAKCEAVDHCALHPCKNGAQCTSLSDSHRCTCAPGFAGPTCAVDIDECKRNPCIHGRCV
NTHGSYKCNCHTGYTGQNCENQYVPCSPSPCQNGGACKAIDSLNYECRCPPGFAGTNCQE
NVNDCPGHLCQNGATCVDGVNSYTCQCPPSFTGPYCNQDVDECALRPSVCKNGATCTNTH
GGFSCICVNGWTGSDCSENIDDCAGAACFNGATCHDRVGSFFCQCAPGKTGLLCHLDDAC
ASNPCHAGAICDTSPIDGTYMCSCPNGYKGVDCTEDIDECEAGSPCEHDGLCVNTPGSFR
CNCTRGFTGPRCEININECDSNPCQNDGTCLDERGAFRCVCMPGM
Download sequence
Identical sequences E9HEQ0
jgi|Dappu1|61886|e_gw1.108.26.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]