SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|65192|e_gw1.210.8.1 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|65192|e_gw1.210.8.1
Domain Number 1 Region: 223-246
Classification Level Classification E-value
Superfamily DPY module 0.000000248
Family DPY module 0.0011
Further Details:      
 
Domain Number 2 Region: 165-188
Classification Level Classification E-value
Superfamily DPY module 0.000000915
Family DPY module 0.00093
Further Details:      
 
Domain Number 3 Region: 323-346
Classification Level Classification E-value
Superfamily DPY module 0.00000183
Family DPY module 0.0014
Further Details:      
 
Domain Number 4 Region: 72-226
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000502
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 5 Region: 238-380
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000581
Family Growth factor receptor domain 0.01
Further Details:      
 
Weak hits

Sequence:  jgi|Dappu1|65192|e_gw1.210.8.1
Domain Number - Region: 24-57
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000104
Family EGF-type module 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|65192|e_gw1.210.8.1
Sequence length 391
Sequence
MTGDPFVRCTEPVVVQPETVTTRPKDPCTPTPCGVGAECRSQGNSATCKCPINYVGDPYT
GCRPECVQNSDCPRDKSCANNRCINPCPGVCGLNAECRVINHYPVCSCISGYTGDASSAC
LKKPPTPNPCVPSPCGANAVCRDQSGLAICQCLPEYFGDARQGCKPECVLNSDCASTQVC
VNQKCRDPCPGLCGNNAECRVVNHFATCYCPQGYTGSPLESCRPECLLNSDCESTLACIN
QKCKDPCAGICGQGAECHVVSHNPICSCPRGKTGDPFIECRPTPVVKPCDPSPCGPNSIC
RPVGSEPVCSCQSGFDGVPPECRPECISSSECPPSKACVNMKCQDPCPGACGRDAQCRVV
NHSPICICPSGWTGDPLTGCRIIPSKHDYND
Download sequence
Identical sequences E9HR62
jgi|Dappu1|65192|e_gw1.210.8.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]