SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|65219|e_gw1.210.12.1 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|65219|e_gw1.210.12.1
Domain Number 1 Region: 36-59
Classification Level Classification E-value
Superfamily DPY module 0.00000112
Family DPY module 0.0014
Further Details:      
 
Domain Number 2 Region: 309-332
Classification Level Classification E-value
Superfamily DPY module 0.00000248
Family DPY module 0.0018
Further Details:      
 
Domain Number 3 Region: 137-160
Classification Level Classification E-value
Superfamily DPY module 0.00000327
Family DPY module 0.0016
Further Details:      
 
Domain Number 4 Region: 199-222
Classification Level Classification E-value
Superfamily DPY module 0.0000034
Family DPY module 0.0018
Further Details:      
 
Weak hits

Sequence:  jgi|Dappu1|65219|e_gw1.210.12.1
Domain Number - Region: 1-30
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00858
Family EGF-type module 0.036
Further Details:      
 
Domain Number - Region: 101-131
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0168
Family EGF-type module 0.044
Further Details:      
 
Domain Number - Region: 271-303
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0293
Family EGF-type module 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|65219|e_gw1.210.12.1
Sequence length 387
Sequence
CDPNPCGTNAQCKSQNGAINCVCPANYVGDPYSSCRPECVLNTDCPRDKNCVNSRCVDPC
PGTCGINAICRVTNHIPVCSCKESHTGDPYGSCRPIPPPTPCDPNPCGTNAQCKTRNGAI
DCSCPGNYVGDPYSSCRPECVLNTDCPRDQSCSRNRCIDPCPGTCGLNADCRISNHIPVC
TINCVCPASYIGDPYSSCRPECVLNTDCPRDKNCLQNQCVDPCVGTCGFNADCRVSNHLP
VCSCKESHTGDPYGSCRPIPVIIEPNVVQPPTPCDPNPCGTNAQCNTRNGAINCVCPANY
VGDPYSSCRPECVLNTECPRDKNCVNYRCVNPCPGTCGINAVCRVTNHIPVCSCKESHTG
DPYGSCRPIPVKRKTRNSNFGRKKQLF
Download sequence
Identical sequences E9HR63
jgi|Dappu1|65219|e_gw1.210.12.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]