SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|65279|e_gw1.211.10.1 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|65279|e_gw1.211.10.1
Domain Number 1 Region: 270-333
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000229
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 2 Region: 160-224
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000101
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 3 Region: 239-279
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000172
Family Complement control module/SCR domain 0.0029
Further Details:      
 
Domain Number 4 Region: 75-149
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000135
Family I set domains 0.052
Further Details:      
 
Weak hits

Sequence:  jgi|Dappu1|65279|e_gw1.211.10.1
Domain Number - Region: 3-40
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000236
Family Complement control module/SCR domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|65279|e_gw1.211.10.1
Sequence length 343
Sequence
IPHGTTLVARCPVLGKMKLLGAFSIQCFNGKWSDKLPTCLPTTPSDGLSAFVDDHPPTIK
TNIPTGSAGENAAGELVVRPRSVVHLDCIFYRKLGNPRWTWKKSNNLTRNHPFGWAIARE
ERLWRFRISIFSIQARDEGEYTCTTPRGHNNSIRIVVQTIQCPQLSMVESPLKAVIEGNH
AGQKAIYLCMDGYRLLGSNSSECLTSGLWSETKQPVCELIQCPYDMDGADPRLEFDFLNG
VKFSCPPGYQLIGPTNATCQKSMNWFPSPPSCQVVECPELLPPLNGRIKESGSNHFVGDV
VKFSCNRNFQLLGQSEISCMENGTWSFSAPQCKASQFMFNYMR
Download sequence
Identical sequences E9HR82
jgi|Dappu1|65279|e_gw1.211.10.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]