SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|65845|e_gw1.262.20.1 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|65845|e_gw1.262.20.1
Domain Number 1 Region: 232-264
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000157
Family LDL receptor-like module 0.0024
Further Details:      
 
Domain Number 2 Region: 1-102
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000877
Family Spermadhesin, CUB domain 0.01
Further Details:      
 
Weak hits

Sequence:  jgi|Dappu1|65845|e_gw1.262.20.1
Domain Number - Region: 112-156
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00262
Family Spermadhesin, CUB domain 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|65845|e_gw1.262.20.1
Sequence length 381
Sequence
ISSPHFPAVYPQDYSNEIKLQNLDFVNSTTSNTGCIMLIFDDYALGLSSFIEISDSNEVR
QYALGSSLFRPPVVLIQSYKMAIRFFANGGRASGYRASYKFINESADLIEIPITDCGGLV
DDFGGVITMYNMSSPNAARLYDCIWLIKPLPTYQQNTKSHLFVRVEQLSSLGKFNLATFY
EFSTTNISPQSLTSEYLVPADVGFYIRLRGRLNNEFKMAIAYAAFSYTECFAIKDFVCLN
HRCISSDLRCDGFNHCGDDSDEQTSCSDKAAISPQDPIWWMTHTPKYYFPKLNDYGDFGA
TSFVLLVATLGVVLFIASILALLYRMSSHSQLMRERQARLDFIRSQIINNPDEREVEIEN
PPSYEAPPDYAEIAKIAQMEK
Download sequence
Identical sequences E9HTS5
jgi|Dappu1|65845|e_gw1.262.20.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]