SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|95750|fgenesh1_pg.C_scaffold_3000515 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|95750|fgenesh1_pg.C_scaffold_3000515
Domain Number 1 Region: 132-193
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000000000288
Family Tachycitin 0.0066
Further Details:      
 
Domain Number 2 Region: 75-119
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.000000000811
Family Somatomedin B domain 0.0017
Further Details:      
 
Domain Number 3 Region: 36-75
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000000484
Family Somatomedin B domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|95750|fgenesh1_pg.C_scaffold_3000515
Sequence length 194
Sequence
MKLTLSFVVVCGLMSCALLVEAKSSNSFRELISNKAGSCAGRCGQSGTDSTKPCQCNLSC
QTYGDCCDDYLTLCNSCDGRCSAAYDNKWPCQCNVDCPSYGNCCSDYPALCQGVTTTVKT
TVTVPDLTTTTTPVPTTPFSCPDDYTAKHPNPDDCHSFYECVAGVAYLVNCPPGLYYNPD
LQVCDYLDNVPSCQ
Download sequence
Identical sequences E9FUN0
jgi|Dappu1|95750|fgenesh1_pg.C_scaffold_3000515

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]