SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|97244|fgenesh1_pg.C_scaffold_6000311 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|97244|fgenesh1_pg.C_scaffold_6000311
Domain Number 1 Region: 50-179
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.15e-20
Family Spermadhesin, CUB domain 0.0019
Further Details:      
 
Domain Number 2 Region: 199-333
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.9e-18
Family Spermadhesin, CUB domain 0.0024
Further Details:      
 
Weak hits

Sequence:  jgi|Dappu1|97244|fgenesh1_pg.C_scaffold_6000311
Domain Number - Region: 363-400
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0011
Family LDL receptor-like module 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|97244|fgenesh1_pg.C_scaffold_6000311
Sequence length 635
Sequence
MQFVEKLLALATISLHHEQFRTHHRTAIVRAEKQPQTCLYEFRSTELPYGNFTSPNYPDF
YPAGTHCYYVFHGRKWEGIRIQFHFFDLESPYTVGYINLVASFCIDFHLIAFVLKSTYLS
RCLSDFVSITTEDVSGLRTVAGRYCGQQTPPPLLAMQPKVEILFAANYVHHHRGFSASFS
FVDEESLTLAPSNADSNSGCGGTISGSGGVLLSPGYPSALQSWLDCSWLLRVPFQHHVYV
RLEYLQLHGGLASCPLAELSIHDGYGPLNDQALKLRRFCGDLRYYKSVSDRSLLSRRNRL
LVRLTSGNLTSFKSLGSRSPVVPFGFRLIWTAVDFQTEQNCLSQGKIVCRDSQYCFNFRR
FSSISCDSTLLFCLDSSLRCDGVMNCEDGDASDELSCQVPYLFASITAVLCALSVGALVF
WFRQRMRNRDKVAEELSYSSAVNYWEPGSCPRHDDRVFHTNNEAPAMDGQKRLSYGGGGE
RRETVHREARRIASLPLINCQKISPNINNGVNLLRRHNSRYEIGSDELYPCQMKAPVVCQ
EQPMPGKLVWDRGAARTASTSVRGNNFVDKNYLRQKKMTNQSNVESYCKETVELTPFKPY
ALSCQDLVAQREMRHSNVVTVTSFGPNETINTELW
Download sequence
Identical sequences E9FZA8
jgi|Dappu1|97244|fgenesh1_pg.C_scaffold_6000311

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]