SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|97268|fgenesh1_pg.C_scaffold_6000335 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|97268|fgenesh1_pg.C_scaffold_6000335
Domain Number 1 Region: 199-286
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000343
Family V set domains (antibody variable domain-like) 0.062
Further Details:      
 
Weak hits

Sequence:  jgi|Dappu1|97268|fgenesh1_pg.C_scaffold_6000335
Domain Number - Region: 533-600
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000367
Family I set domains 0.021
Further Details:      
 
Domain Number - Region: 33-81
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.012
Family Hairpin loop containing domain 0.044
Further Details:      
 
Domain Number - Region: 320-397
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0175
Family I set domains 0.067
Further Details:      
 
Domain Number - Region: 421-461
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0271
Family I set domains 0.093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|97268|fgenesh1_pg.C_scaffold_6000335
Sequence length 643
Sequence
MSSLYILFGNALLSVIHLVEADWNTGDGGFNWRTNCDFPGDDIGHIPLTVATREECGRLC
ISNPQCSHFVFGYLENCYMKNAPSMPPRQDIDYESIAICGFIPWRFGSEPVSDDWKSISG
SGAHNCGFYGNNSLILTAECRQAQDCSFWYEQVPPTEGSSACKLVDGSFGSCCPQLPKTP
EFPQETQYITMIPDERKRIIEAGTTLTLTCVYAFEDENQRNAYNFSWEIPNYLTKNTELS
DLDNRLRKTFGRNETHMTSTLSLANARARDTGDFLCKGIPVGYKSIFTVNQYVYVFNDTE
LVILDANEFYIVIPHGETNYPIKCIPTHPDVNVSLIFEQQFTAIAKNIMEPKTDLISDPN
SNWSFEKRKGLKLKKAKIDDNGKFSCIGTYNNKKTSSLYSDFFLFVPGMELTRSDGEDDP
FEGSNVTLGCRTYQYTKNSYPPKWSYQINRNGQMQIIDEINPPEGIEITSEKFDYEGKTL
YENQLYIFDISPNAYTFQCQGSEFTENISFRSKELNGDSQLKSIQLEKDIAQNLTCFKGS
QNARIKWFKDGKEYSGQFYSDDTSSILPLQGKMGENGKYACQWKVSFPGDVKYRNFTVSD
IDRVSENDKTVVIAVSTTFAVLLLVIFIGLMIFAGVKFYYDKV
Download sequence
Identical sequences E9FZF1
jgi|Dappu1|97268|fgenesh1_pg.C_scaffold_6000335

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]