SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|98236|fgenesh1_pg.C_scaffold_9000029 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|98236|fgenesh1_pg.C_scaffold_9000029
Domain Number 1 Region: 26-123
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000055
Family Spermadhesin, CUB domain 0.0093
Further Details:      
 
Domain Number 2 Region: 131-163
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000275
Family LDL receptor-like module 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|98236|fgenesh1_pg.C_scaffold_9000029
Sequence length 348
Sequence
MPADHVASLCKSHFLQQLYRKIDGAVLRSQNEHNLDCLITFQTETVLQRFMLRFDQLQLD
CNDHLFIYDGAHATGVYKADLSCRHTRQSVGTITTRTNFVTLKYVTDAWGTETSGFHLVV
TAFKDKTEFVCRDFRCAQKDFCISTDLLCDGVNHCGDNTDETTTSLCADSNQHFKILGLN
LPVFGAVAGSIGVVILCAVTAIIVVCCCRRKKPPTTSAGAAAASSGNNGRLVDDGNQQQK
PIANLLSNDSAVKMPLPTTTTPGGYMTLPLNKSSAVTMSGNRHPPAIDQGHFLRRVTTMG
MQLAHLSSSNSPTITRNSSAHCRGTTINNTTTVHLLNSSSFNFWCLAI
Download sequence
Identical sequences E9G466
jgi|Dappu1|98236|fgenesh1_pg.C_scaffold_9000029

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]