SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|99760|fgenesh1_pg.C_scaffold_13000013 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|99760|fgenesh1_pg.C_scaffold_13000013
Domain Number 1 Region: 38-94
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 9.42e-16
Family Tachycitin 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|99760|fgenesh1_pg.C_scaffold_13000013
Sequence length 197
Sequence
MFRQFTCIVVSCLLVLQFLTFVVLSPTGQAKLFFKPSVYCSGVNELSSDPTSCSNFYSCI
ANRLAIRMSCGAGTYFNPTLLICDWPDNVQCNVHGQDKSFVKEVNSERFRPDSAGQLRGP
PGISGENFEQGMDDPEFRRGISSPSDARLLGVHLNLLSLLKGPAGPPGPPYLVRQGQQHL
HISIIISIHIASNASWP
Download sequence
Identical sequences E9G872
jgi|Dappu1|99760|fgenesh1_pg.C_scaffold_13000013

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]