SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|101895|fgenesh1_pg.C_scaffold_19000089 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|101895|fgenesh1_pg.C_scaffold_19000089
Domain Number 1 Region: 967-1018,1054-1112
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000116
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 2 Region: 246-380
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000353
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 3 Region: 444-486,516-611
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000832
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 4 Region: 793-854
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000912
Family EGF-type module 0.01
Further Details:      
 
Domain Number 5 Region: 680-807
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000116
Family Growth factor receptor domain 0.0095
Further Details:      
 
Domain Number 6 Region: 400-473
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000205
Family EGF-type module 0.0067
Further Details:      
 
Domain Number 7 Region: 197-241
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000252
Family EGF-type module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|101895|fgenesh1_pg.C_scaffold_19000089
Sequence length 1574
Sequence
MGHWTTRLPLIGLSLLLLTDVYGDFEQPLSHCCNLGVKWGVENLQCAAFPAPVVGIRNEQ
QAICLSAVHICCLRKHRERQCELGKQSARADRECSVNRDLGGETHKDCCEGCKLGLVAGS
MSMGCTFRAFQFGAPWDDAYRSCCQQTLPQVFPDNPLPNLRVPSSTPRAQIPPFLPPPPT
PALPSYPIDEQNSIEDDEDLCARFPGELCAHVCVPTGGSSYRCECREGFQLLADGKSCQQ
ATQYDRCSSDNPCSQKCTDTGLAVECSCHSGFQLASDEKTCTDVDECLIGADNCDVLLQI
CVNQPGGFACIERKDSPVSTGSRPAAASPESSSEGRGCPRGFKFNPESRVCDDVNECETQ
PPVCPAQTSCQNTIGSYNCARRPQLEECPLGFRFNNQIQTCIDIDECKENPATCPKTRPV
CVNLQGSYTCQARNESSLLGPSVTCPAGYKFNTAQQTCEDVDECAERLDTCVHGMEMCIN
DLGRYHCEPLSADAASTTTGQRHHDVEDHHQIPNYGQCPTGYTYDEDEQVCIDLDECLNG
QLDDLSLCDDDKRCANTEGSYECVEACAPGYQPDVADAMGPCVDMDECLNNNHNCTLAEK
CVNVPGSYRCEQLRPVLQTVSIPATTTTDFNTRPIPVSRVTSSTTTTTTTTTRPTTTTTT
PTTTTTTAPPTTRAARQQHNSSGSCPSGFRKEAGGGRCKDINECEEGTHRCEPSKSDCVN
TAGSYRCKPLTPCLSGFRRNTSTGRCEDIDECIEGSHNCTTQTELCVNNYGSFDCRPYPF
CPAGHSFSVQERFCKDVDECAEGTHNCSGTCVNAVGTFRCVDREPVSCGLGYRYDTEKRE
CQDLDECREGTNPCRPPAERCVNMVGTYRCEPISLPTTTRATTKATTTTTPRPTTTTTTP
RPTTTTTTRPTTTTTRSTTTTTRPTTTTTRPTTTTSTTTTTASTTTSTTSATTPKPNFST
ISSRPGGSSQNDRCQAGFRYSRRTRNCQDIDECVEARDYCNKETEVCVNERGGYRCVPFN
ELPATSSSVAPNPLTTTTTSAPLSTNRPPPRTPSCPRGYVFSDDSRRCIDVNECTNDQNP
CRGNQQCENTVGSYVCRCPVGYRFNTATQFCEARRGATTRSAVTPASARPAVARATPTTP
KRADAKTMTSANREQTTAPTSARSISAATRRARSVASARNATTAQTGTPCWTRRRAAVFN
LHNALQASNQHPEADAMMSTSVPNQLTTARGISCVKIAQAAMSASVNRDTRSELTGSARI
LMNVHDSLGRFVRRIHNAPTRQDLTDATARKDSAQDRIPVHALISTNAPKRPACANRIVP
TLGARTSAVVSRVTPWLPIIGRVTMSTSANCTKTVEVCASVCASTSLAVIRANVPTDIVW
LPTTALAKISTNASDRECVVRKRLVSTPEAVTIATPSSARPTTFVTPSTASTRCKRVSLE
CHSWDTECLRKPVSYSYNFLTLPSKIPIPARTGHLDLFSMRGPLWASATVQFNLELNDVR
APNDLVDRKLKVDRNVFSLRRSTSSPNQAILALTKSIVGPQEIELFLNMDMYQNGVFSGV
AVVKIFIYVTQYDF
Download sequence
Identical sequences E9GEU9
jgi|Dappu1|101895|fgenesh1_pg.C_scaffold_19000089

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]