SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|106356|fgenesh1_pg.C_scaffold_42000069 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|106356|fgenesh1_pg.C_scaffold_42000069
Domain Number 1 Region: 66-123
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000000118
Family Tachycitin 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|106356|fgenesh1_pg.C_scaffold_42000069
Sequence length 145
Sequence
MITSSNAFSNYSNSQSGIPKVNIHRKMMRQVAVLLCVAFAVSLVYSLPALHRAKRWEEFP
NVTLTFDCTDRPLGFYADQEFECMLFHMCDEDGRRIPYMCGSGTAFNQQYRICDWIHNFD
CKEADKWFYLNELTYVTDPPKQIKA
Download sequence
Identical sequences E9GTM2
jgi|Dappu1|106356|fgenesh1_pg.C_scaffold_42000069

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]