SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|188760|estExt_fgenesh1_pm.C_610015 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|188760|estExt_fgenesh1_pm.C_610015
Domain Number 1 Region: 32-97
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000000000471
Family Tachycitin 0.024
Further Details:      
 
Domain Number 2 Region: 112-174
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000000115
Family Tachycitin 0.025
Further Details:      
 
Domain Number 3 Region: 176-229
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000154
Family Tachycitin 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|188760|estExt_fgenesh1_pm.C_610015
Sequence length 229
Sequence
MKETILVALLLQVSFTRSEVVLNQKLHNHKEMFENFICPEPNGVFPSETCSDYYLCVEGV
PYVQHCPGDSIFDPQTQVCLPPGANSCQGITTTSTTTQSSTYTSSSTTSSTITTPAVFTC
PSSSGFYPVPESPCSNLYYTCISGVPYLSTCPGGSIFDPVALICVSPDSASCSPTFQCPS
DSGSFPIAGACSNKFYTCVSGKSYEQNCIENYVFDTIRLKCIPSEEASC
Download sequence
Identical sequences E9H1M2
jgi|Dappu1|188760|estExt_fgenesh1_pm.C_610015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]