SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|189897|estExt_Genewise1Plus.C_10161 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|189897|estExt_Genewise1Plus.C_10161
Domain Number 1 Region: 32-279,351-397
Classification Level Classification E-value
Superfamily (Trans)glycosidases 5.4e-97
Family Type II chitinase 0.00000153
Further Details:      
 
Domain Number 2 Region: 279-350
Classification Level Classification E-value
Superfamily Chitinase insertion domain 8.51e-19
Family Chitinase insertion domain 0.001
Further Details:      
 
Domain Number 3 Region: 504-563
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000000152
Family Tachycitin 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|189897|estExt_Genewise1Plus.C_10161
Sequence length 566
Sequence
MKVVGLIACCVFAVAIHFSNGAAVEPKAGGKSMVCYYGSWAVYRPGNGKFDVEQIDPFLC
THIIYGFTGLGTDNTMIPLDPWNDLYDNWGKGAFLRFTGLKQQNPNLKALIAIGGWNEGS
EKYSRMVSDPAKRATFVNSVVNFIKKYNFDGLDFDWEYPANRGGLPSDKQNYISMIRELK
NAFTPYGWLLTAAVSPGKSTIDSAYDIPALAGILDQVHVMNYDYHGSWETYTGLNAPLYA
NPNYDLTMDNQFLNANWTIYYWLSNGVPPSKIIMGMPLYGRGFQLDNSAKNGFYASASNP
IPAGPYTQQAGTWGYNEICEKFKADGTWTVVRDSCYQTPYAYKNNLWIGYDDEQSLRNKG
KYIAAMNLGGALTWSIETDDFRGYCHGTPFILTKSIVEAMNGPTNLMPTNPCSPGSPPPP
TPPPIDTTTKPTTIQITTPNKVTTTTTATPSTTTTKISTNPTPTITSTPSSTPSCTCVVP
TGTPAPPVTTTASSSGGTTSEPNSVCKKEGLNADPNDCGIFYQCIAQASNGWLVYTQHCP
VGTVFDAKIDVCDFPQKVPGCENYYG
Download sequence
Identical sequences E9FRW2
jgi|Dappu1|189897|estExt_Genewise1Plus.C_10161

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]