SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|194525|estExt_Genewise1Plus.C_130008 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|194525|estExt_Genewise1Plus.C_130008
Domain Number 1 Region: 25-274,348-407
Classification Level Classification E-value
Superfamily (Trans)glycosidases 9.3e-95
Family Type II chitinase 0.00000105
Further Details:      
 
Domain Number 2 Region: 406-463
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 3.4e-19
Family Tachycitin 0.0034
Further Details:      
 
Domain Number 3 Region: 266-339
Classification Level Classification E-value
Superfamily Chitinase insertion domain 1.19e-16
Family Chitinase insertion domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|194525|estExt_Genewise1Plus.C_130008
Sequence length 465
Sequence
MKMLLLSLMGLLAFGSYPGIDAQSSRIVCYFPNWARYRTGAGQYTVDNINPNLCTHVIYA
FAILDGTTYKIKIFDDWADISLNGFQRAVALKTQNPKLKVMIALGGWNDSNDGTGKYSKM
VSSTANINTFVTSAVAFLQQFKFDGLDLDWEYPSTAADKTGFKNLIVALRNAFQASGYLL
SAAVSASAASIDAGYDVASMNQNLDFINLMTYDFHGAGWEPNTADHHSPLLKRSGETTNF
NSDFAVTYWIGKGMPASKINMGIPLYGMSWKLTSTTIAPPAPASGVGAAGPFTSTAGFLA
YYEICSAVRSSGWQVVQDPTKAIGPYAVSPTSPKTWVGYDDPAMAIVKSKYILSKGLGGG
MVWDISLDDFQNTCGAGANPVITAIYSTLTNGSATIITTTTSASTQTSIVCPSPNGLFPD
PASCSNFYSCSNGLAIKMACGSGLYFNPTLLVCDWPANVKCTISG
Download sequence
Identical sequences E9G876
jgi|Dappu1|194525|estExt_Genewise1Plus.C_130008

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]