SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|21404|gw1.11.206.1 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|21404|gw1.11.206.1
Domain Number 1 Region: 2-143
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.09e-23
Family Laminin G-like module 0.013
Further Details:      
 
Domain Number 2 Region: 197-257
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000022
Family VWC domain 0.007
Further Details:      
 
Domain Number 3 Region: 433-534
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000144
Family Growth factor receptor domain 0.0091
Further Details:      
 
Domain Number 4 Region: 259-323
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000628
Family VWC domain 0.086
Further Details:      
 
Domain Number 5 Region: 670-740
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000711
Family VWC domain 0.024
Further Details:      
 
Domain Number 6 Region: 320-370
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000543
Family EGF-like domain of nidogen-1 0.068
Further Details:      
 
Domain Number 7 Region: 357-403
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000227
Family EGF-type module 0.01
Further Details:      
 
Domain Number 8 Region: 550-580
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000254
Family EGF-type module 0.015
Further Details:      
 
Weak hits

Sequence:  jgi|Dappu1|21404|gw1.11.206.1
Domain Number - Region: 580-629
Classification Level Classification E-value
Superfamily FnI-like domain 0.00942
Family Fibronectin type I module 0.082
Further Details:      
 
Domain Number - Region: 152-196
Classification Level Classification E-value
Superfamily Rad50 coiled-coil Zn hook 0.0379
Family Rad50 coiled-coil Zn hook 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|21404|gw1.11.206.1
Sequence length 744
Sequence
DITFVAAVRQEPYNVGTLFSLSEGFTRFLELQSSGRKDEIRLHYNHLGAPRTETFNFRLA
DGAWHRLAVTVSGGVASLYVDCHRVERRWMAAIPDTAFTPESSPLPVQEQNKPGKMSLWI
GQRGDQHFLFKGAMQDVKLVAGSNGHLVQCPAAEAECPTCGEFHSLQSVVARLEKSLQHL
TNKLEHAEERLTQLEQCDCPRSCSVNGTVHADGSSWNSDCEVCSCHKGQVTCSPVQCPDT
PCRNPVQLPGECCRTCLKQCYFRGLNYDHGERVSPRHCLECQCLNGSMQCRPLDPELHCP
ALSCPPSEQFTVANECCKQCPGVDYCASANRVCHARAQCINLQTTYACHCSPGYTGDGKH
CSDINECDTEGGPGGHRCGANTVCINTAGSYRCDCLPGYFHLGSGPGSAVDVHHNGTECV
EYDECANKLDNDCHPTLATCLNTPGSYQCACRPGYRGNGIECEPVCDRPCQNGGRCVGPN
QCSCRRGFEGDYCEMDVNECERTGNKTTGHQCHLNSECRNMPGWYACACKPGFRSPRQDI
LDTFLGALYIDECAEGLHSCHGNTQCLNTIGSYECRCPPTNPNCSLVCHTEEGVRQSGET
WISYESPCVSCQCREGVVTCSKLPCHCTSTSSSSSPPASSSSSSDDLEATAKFGLHRNQT
VVHHPNSELCCPQCRASKSQQCRHQEKSDVIFDSGQRWIYQCQSCECLHGETDCWPMECP
PVYCSHPIRLPGDCCLRCPDSDPC
Download sequence
Identical sequences E9G653
jgi|Dappu1|21404|gw1.11.206.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]