SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|220975|estExt_fgenesh1_pg.C_30495 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|220975|estExt_fgenesh1_pg.C_30495
Domain Number 1 Region: 97-165
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000000000942
Family Tachycitin 0.017
Further Details:      
 
Domain Number 2 Region: 44-100
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000000251
Family Tachycitin 0.028
Further Details:      
 
Domain Number 3 Region: 380-442
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000000471
Family Tachycitin 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|220975|estExt_fgenesh1_pg.C_30495
Sequence length 443
Sequence
MAKHFLTSLLLAISIFQVGLSAAVNKISEQKWGRKMTFNGQTKVFTCPEAEGSYATPNQC
IAQYYECVNGIAYPQTCPPGYLFDPITLVCTLAAQTTCNQHIDCPSDGLYPYPGACSSLY
FVCNNGDSYLRYCPENYVFDPTLQRCVLQEDATCTSTTYSTTTTTVPSPTTPPMPTTKPV
TTTEPTTTTTEATTTTQSTTTTTAPTTESTTTTTLPTTTTTEATTTTTEATTTEATTTTL
STTTTTVPTTTTAEATTTTTEAATTTTTAPPTESTTTTTLPTTTTTEATTTTTEAATTTT
TEAITTTTAPTTTTTEATTTTESTTTTMVPTTTTTEPPTTTTKTTEPPREESTTTTAAPI
TTTLTPANTPPITTTTNTTPIKPAEPFVCPQSDGLFPVPGVACSNQFWMCSNFYAYLMDC
PVPIFYNPAIQVCDWKENIAGCN
Download sequence
Identical sequences E9FUK7
jgi|Dappu1|220975|estExt_fgenesh1_pg.C_30495

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]