SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|223236|estExt_fgenesh1_pg.C_140179 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|223236|estExt_fgenesh1_pg.C_140179
Domain Number 1 Region: 47-105
Classification Level Classification E-value
Superfamily (Trans)glycosidases 0.0000000226
Family Type II chitinase 0.0053
Further Details:      
 
Domain Number 2 Region: 6-47
Classification Level Classification E-value
Superfamily Chitinase insertion domain 0.000000692
Family Chitinase insertion domain 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|223236|estExt_fgenesh1_pg.C_140179
Sequence length 111
Sequence
MGVNNTMAFYEICSAVRNNGWKVFSDPTGKIGPYAVSPTDPKTWVGYDDPVMAIVKSQFI
LSEGLGGAFLSDISYDDFRDTCGLGVNPITTAIYNTLNGLSSTCDCVCYDN
Download sequence
Identical sequences E9G9Z2
jgi|Dappu1|223236|estExt_fgenesh1_pg.C_140179

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]