SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|223896|estExt_fgenesh1_pg.C_180318 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|223896|estExt_fgenesh1_pg.C_180318
Domain Number 1 Region: 186-469
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.59e-36
Family Eukaryotic proteases 0.003
Further Details:      
 
Domain Number 2 Region: 69-148
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000393
Family Spermadhesin, CUB domain 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|223896|estExt_fgenesh1_pg.C_180318
Sequence length 482
Sequence
MIRFVTVVLLLAWSSWNWAIAESTFEDDNNVKFVYNSELGGDELQGSDSSKAANADAPCG
PMYKICRDFNATTTSGIIQPLDPLVVGPSPKMCSFSIVAPPGYRIQMTCSIVQISRSCSF
LKLRDGQVVLADPPTVDEVYTSNGNVIVVDSQLLHYGNTFDCKWTMIAPTTTTTTTTTTQ
RPLTTECGRSKFTSSRILGGTEANPNEFPWMVHLVVNKDGGPYTCAGTLISNQYFVTAMS
CFVDSKGNVSWSGFTTITLGAHDFSSNSNDRNRQVVQWTSGQLGGWPQYVVEGDWAIFKL
NQPAILNGIITSSHSRSRLLLRNDRQQTNHDSRANADYVQPACLPFANEPDHLNDPVVLT
GWGDYIPGVPSPVLRKTTTAVISSAGTNGQCQQTAGIGPFSGDKVICSDGSKGRRLCKGE
KGGPMNYYNKELGRWFFIGIGMRRDESNCLTNCKPNVFTRVKAILPTICGFSGVTPPDGK
CS
Download sequence
Identical sequences E9GEG2
jgi|Dappu1|223896|estExt_fgenesh1_pg.C_180318

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]