SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|225360|estExt_fgenesh1_pg.C_340008 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|225360|estExt_fgenesh1_pg.C_340008
Domain Number 1 Region: 372-762
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 4.58e-120
Family Oxysterol-binding protein 0.0000446
Further Details:      
 
Domain Number 2 Region: 110-231
Classification Level Classification E-value
Superfamily PH domain-like 3.01e-21
Family Pleckstrin-homology domain (PH domain) 0.00000425
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|225360|estExt_fgenesh1_pg.C_340008
Sequence length 910
Sequence
MDRSSAEPSPSQPSSPNLYTSTPNKFKNASSSTESAQVPQSVIDRVQCGNETQQLDWQGP
GNGESAPSSSPGTVPSPGFMVARKESYKLQRKNYRFEKKKAANELLCSFKDPAVVVLADW
LKVRGMLKSWTKLWCILKPGVILLYKSDKAKDWVGTILLSMCKLIERPSKKDGFCFKLYH
PLDQSIWAPKGPLGETIPAPIQPLPTSHLIFRVSSQGAGKCWMDALELALKCSSLLIRSM
STRSTNIGEGLVSDLASGHPISGASASQSGDLHWNDSDFEKHFKDQDFDDTSHTDENDIT
EAERRSGSGLDVADFATVGPRLPRTRRDSHHSDSESEEDELRSLDDFPVETPYVVQQEEE
FGSTGELTEELADDNKSLIWFLVKQVRPGMDLSKVVLPTFILEPRSFLDKLSDYYYHADI
LSRAVLEDDPFTRMKTVVQWYLSGFYKKPKGLKKPYNPILGEVFRCCWKHPNGSTTFYIA
EQVSHHPPISALYVTNRKDGFTLSATILAKSKFYGNSLSALLDGSARLTLLPRGEDYVIT
MPYAHCKGILLGTLTMEMGGEVYLKCEKTGYRADLEFKLKPMIGGADFMNYVTGKLRLGK
ETLATISGYWDDCITIEDKRTGEKQTLWNPTSEVRATRLKRWTVASEEQLGYESDKLWSK
VAAAIRQENQVFDLNKNELATSEKTILEEAQRNATKLRISQNETWMPRCFELDPVTDSWH
YRHADVRPWDQRNDVVQYESNFVIATKTRHRTPMIREASIVSVERQTESIRQQLVLSSPN
GPEFRKPLSEANVNGASVIRRRNADGSISSSAEGDLLHSSEEDSRLKADKRQLRSGLTSW
NHVLQYLEESHRETQDRLNRIQTSIQSMVLQQHQTLGPKKMMRGSSSRDLYLVVLVLVLC
QVVLWLYWKK
Download sequence
Identical sequences E9GP28
jgi|Dappu1|225360|estExt_fgenesh1_pg.C_340008

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]