SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|231826|estExt_fgenesh1_kg.C_1840001 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|231826|estExt_fgenesh1_kg.C_1840001
Domain Number 1 Region: 164-218
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000000112
Family Tachycitin 0.035
Further Details:      
 
Domain Number 2 Region: 16-83
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000000497
Family Tachycitin 0.016
Further Details:      
 
Domain Number 3 Region: 89-151
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000000549
Family Tachycitin 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|231826|estExt_fgenesh1_kg.C_1840001
Sequence length 225
Sequence
MAVLQFVITLALIGWTQAYNCPYPNGYFPDESRCEKFWECREGVAEEVSCPDGLLVNEKA
AAFRYPCDYPVDVECGKRTIPPAEGPSGNCARKWGMFKTGSDNSCGDFVNCVDGVEHQFK
CPEGLAWHPTLWRCEWPDQVPTCNVEAFLGFKCPDVDEYVAATNPVYGHPTDCARYFVCI
EGNKPRLNVCGPKTVFDKSIGACGAPENVPACANYYPPESEKYSA
Download sequence
Identical sequences E9HPE7
jgi|Dappu1|231826|estExt_fgenesh1_kg.C_1840001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]