SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|232495|SNAP_00000553 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|232495|SNAP_00000553
Domain Number 1 Region: 662-699
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000034
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 2 Region: 753-791
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000209
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 3 Region: 532-567
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000157
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 4 Region: 390-422
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000223
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 5 Region: 791-827
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000089
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 6 Region: 822-881
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000017
Family LDL receptor-like module 0.0024
Further Details:      
 
Domain Number 7 Region: 708-744
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000102
Family LDL receptor-like module 0.0013
Further Details:      
 
Weak hits

Sequence:  jgi|Dappu1|232495|SNAP_00000553
Domain Number - Region: 487-525
Classification Level Classification E-value
Superfamily Phase 1 flagellin 0.0131
Family Phase 1 flagellin 0.089
Further Details:      
 
Domain Number - Region: 448-479
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0511
Family LDL receptor-like module 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|232495|SNAP_00000553
Sequence length 936
Sequence
MGSRAPGASQPGGQEETTDDSSDVGSFTVHFAIVALSLNTSGGGGWEGGNLKNKTLLAFR
LSGAQETPPSGLDDDSDLVFDDGFFGDDEEAWSSVAGETANSRVKREPPPSLEEGERRGG
RHRQLVNGGSSHSTKSASLGHWDRHQQKTKKQLHHQKQQHAETDEKKDAKQHHDHHKAAV
AQKKSQVVARANLKQLEPNHKKPNNNNNNHKSNHSKKNHKKVPVVLKIDDDDEDLMLGDG
SGSGDGEIILPSPPTQGGSGIGTRKMYRCSLLVQEPYNQELGDRESSDFSEMADRFNIAV
DNLYLRVSGTQTTNVQTFERTSQRQLTKVNFDIESQDFDDVKVIESTLRSAVQNGLIGSF
YVESEGFTFRVVEGSAISPLPSPPENPDDCEIQCKSDGQCITLEQRCNGYDDCEDGSDEE
GCAPPSQPDGSEPAPEELDCRGDIKTKCRGPNGLSYCEEDQCDGIVKCPEGDDEEGCSVA
VTSTNAPDPTTTTTTTTTTTTTTPAPTTTTTTTTTTKPTTTTTTTTTTPEPPPVGCQEDE
FSCDGRCLPFSVFCNGQADCSDGEDEIVQSSALSSSGPVAKKPDLSARAAFFIFFFCVYR
FPDSIGYDLRRFVSSFTIGRLNVNMKPVGSSLSVWFFLCVILVASSRSALAQKAKGHRSA
KECRSDEFKCNNNQCIAKTRTCDRYDDCPDGEDEENCSVFEPPTTPAACQGFQCSDGLTC
LDDASRQCDGRADCPDFSDELNCPQPPTSGPEPCQAGEFQCKTDKTCIAIAQRCDGREHC
QDGSDEIGCLCTKDQWQCDFGSCIDVRMRCDGKVDCPTDQSDEANCPAATCPSNQFKCLS
SGRPVPGSGGTGSSAKVQCIPQWQKCDSIDDCIDGSDEISHHVSNHFFSSGLIPSRPWKP
SRNVRRKLITIRINPSQSTGSMVEVSVVEVSVLVTV
Download sequence
Identical sequences E9FR25
jgi|Dappu1|232495|SNAP_00000553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]