SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|234485|SNAP_00002543 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|234485|SNAP_00002543
Domain Number 1 Region: 126-196
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000000288
Family Tachycitin 0.015
Further Details:      
 
Domain Number 2 Region: 213-269
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000217
Family Tachycitin 0.039
Further Details:      
 
Weak hits

Sequence:  jgi|Dappu1|234485|SNAP_00002543
Domain Number - Region: 17-117
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.000392
Family beta-sandwich domain of Sec23/24 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|234485|SNAP_00002543
Sequence length 344
Sequence
MPVSSGMKLTAPNFIDPPPTPPPPTPPTPTPPPPTPPTPTPPPPTPPTPIDPPPTPPPPT
PPPPTTPTPTPPTPPTPPTPTPPTPPTPTPPTPTDLPPTPPTPPPSTTTPSTTTSTTTPR
APKPETPPKPPFSFDCTSDKPLQFPLDCSRFYQCVSDGVQRIIYVFSCLPGLYFDDVSSQ
CRTPAEAVCKDTSSINDTTNSLDGPGGILRLDCNGNLYRYPLNCNNFYTCFKDDEGHEII
NVFACAAGLVFDDLSLRCLLPQETSPCGDSNNLFKSPSFVFQLQEEIDTVSILSKSKDIF
EQQKTKLPKHGELSDLIIPKLPHQSGRGASQNKMRIRMNTYTPK
Download sequence
Identical sequences E9FWQ6
jgi|Dappu1|234485|SNAP_00002543

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]