SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|247963|SNAP_00016021 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|247963|SNAP_00016021
Domain Number 1 Region: 4-47
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000272
Family SAM (sterile alpha motif) domain 0.014
Further Details:      
 
Domain Number 2 Region: 57-103
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000629
Family EGF-type module 0.011
Further Details:      
 
Domain Number 3 Region: 195-228
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000839
Family EGF-type module 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|247963|SNAP_00016021
Sequence length 274
Sequence
MECELFRFNDVDIAVFKTLTNENLLEIGVRSFGARKKLLDAIQDVFISVGKSVCRNGPCS
PNPCLAGGTCVRSTRYADNNRIVSSFKCSCRVGTKGIHCETPYCPTLYCLNGGTCHVNRQ
VKASLAPGASIGAKEQQQSRQDPPQSSSQSPPPTKRFRQPQPFITPVVRFQGDVTRANKT
IGASRGAAGLMGTYCASNPCKNGGRCVDNSHAAPGYFTCFCPPNFQGLGELCDFTPCPTS
GRECVKSEMTDCLSRGKESCSASRDPLTDRLSPW
Download sequence
Identical sequences E9GTF2
jgi|Dappu1|247963|SNAP_00016021

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]